Diaphorina citri psyllid: psy11221

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--

MRIFVISNSSEIVSPLLLRSSATFSNSEFEAFLAKKWSSEKRFGLEGCEILIPAMKQVIDKSTELGVESVVMGMPHRGNLISETTGQGLQKVPRLFSQNPQNNGDIRHFVFFSSTPTFLHTFDWIKASQTQGDRGPHLTLNCWPRAMFLSTPVCILHETFRPIFTPIIFFFFALSHVQMGSAFDIDLSISFRVIALRPTGFG

ccEEEccccccccHHHHHHHHccccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHccccEEEECccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccEEEEEEcccccccHHHHHHHHHHHHcccccccccccEEEEEEEEcccccc

MR*FVI****EIVSPLLLRSSATFSNSEFEAFLAKKWSSEKRFGLEGCEILIPAMKQVIDKSTELGVESVVMGMPHRGNLISETTGQGLQKVPRLFSQNPQNNGDIRHFVFFSSTPTFLHTFDWIKASQTQGDRGPHLTLNCWPRAMFLSTPVCILHETFRPIFTPIIFFFFALSHVQMGSAFDIDLSISFRVIALRPTG**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
2-oxoglutarate dehydrogenase, mitochondrial	The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of three enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).	confident	O61199

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044710 [BP]	single-organism metabolic process	probable	GO:0008150, GO:0008152
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0046872 [MF]	metal ion binding	probable	GO:0043169, GO:0003674, GO:0005488, GO:0043167

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XT6, chain A
Confidence level:very confident
Coverage over the Query: 9-116,129-174
View the alignment between query and template
View the model in PyMOL