Diaphorina citri psyllid: psy11243

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MYLPRGYRELKSELYPQCFLPFMTGPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNFTLDLDEPCHIRLRERRRKD
cccccccccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHccEEEEcccccHHHHHHHHHHccEEEEccccEEEEEEEccccc
MYLPRGYRELKSELYPQCFLPFMTGPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNFTLDLDEPCHIR*RERR***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLPRGYRELKSELYPQCFLPFMTGPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNFTLDLDEPCHIRLRERRRKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome P450 4F8 Hydroxylates arachidonic acid (20:4n-6) to (18R)-hydroxyarachidonate. Shows little activity against prostaglandin (PG) D2, PGE1, PGE2, PGF2alpha, and leukotriene B4. Catalyzes omega-2 and omega-3-hydroxylation of PGH1 and PGH2. Catalyzes epoxidation of 4,7,10,13,16,19-(Z)-docosahexaenoic acid (22:6n-3) and 7,10,13,16,19-(Z)-docosapentaenoic acid (22:5n-3) and omega-3-hydroxylation of 4,7,10,13,16-(Z)-docosapentaenoic acid (22:5n-6). Catalyzes hydrxylation of PGI2 and carbaprostacyclin.confidentP98187

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046483 [BP]heterocycle metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:1901360 [BP]organic cyclic compound metabolic processprobableGO:0071704, GO:0008150, GO:0008152
GO:0019369 [BP]arachidonic acid metabolic processprobableGO:0044238, GO:0006631, GO:0008152, GO:0006082, GO:0071704, GO:1901568, GO:0009987, GO:0044710, GO:0019752, GO:0032787, GO:0006690, GO:0008150, GO:0044237, GO:0043436, GO:0001676, GO:0044255, GO:0033559, GO:0044281, GO:0006629
GO:0044248 [BP]cellular catabolic processprobableGO:0008150, GO:0009987, GO:0009056, GO:0008152, GO:0044237
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:1901564 [BP]organonitrogen compound metabolic processprobableGO:0071704, GO:0006807, GO:0008150, GO:0008152
GO:0008391 [MF]arachidonic acid monooxygenase activityprobableGO:0003824, GO:0004497, GO:0016705, GO:0003674, GO:0016491
GO:0006725 [BP]cellular aromatic compound metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0018685 [MF]alkane 1-monooxygenase activityprobableGO:0004497, GO:0016705, GO:0016713, GO:0003824, GO:0003674, GO:0016491
GO:1901575 [BP]organic substance catabolic processprobableGO:0008150, GO:0071704, GO:0009056, GO:0008152
GO:0034641 [BP]cellular nitrogen compound metabolic processprobableGO:0009987, GO:0006807, GO:0008150, GO:0008152, GO:0044237

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NXU, chain A
Confidence level:very confident
Coverage over the Query: 1-87
View the alignment between query and template
View the model in PyMOL