Psyllid ID: psy11243
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 91 | ||||||
| 328712467 | 452 | PREDICTED: cytochrome P450 4C1-like [Acy | 0.791 | 0.159 | 0.423 | 6e-08 | |
| 195113985 | 508 | GI21924 [Drosophila mojavensis] gi|19391 | 0.868 | 0.155 | 0.372 | 2e-07 | |
| 195339523 | 526 | GM12308 [Drosophila sechellia] gi|194130 | 0.934 | 0.161 | 0.372 | 3e-07 | |
| 195577899 | 526 | GD22340 [Drosophila simulans] gi|1941908 | 0.934 | 0.161 | 0.372 | 3e-07 | |
| 17647303 | 526 | cytochrome P450-4e3 [Drosophila melanoga | 0.934 | 0.161 | 0.372 | 3e-07 | |
| 443727452 | 530 | hypothetical protein CAPTEDRAFT_220559 [ | 0.637 | 0.109 | 0.431 | 3e-07 | |
| 66772683 | 363 | IP02804p [Drosophila melanogaster] | 0.802 | 0.201 | 0.395 | 4e-07 | |
| 189240567 | 516 | PREDICTED: similar to cytochrome P450 mo | 0.846 | 0.149 | 0.387 | 5e-07 | |
| 195147032 | 526 | GL19213 [Drosophila persimilis] gi|19410 | 0.813 | 0.140 | 0.360 | 5e-07 | |
| 198473596 | 526 | GA17961 [Drosophila pseudoobscura pseudo | 0.813 | 0.140 | 0.360 | 5e-07 |
| >gi|328712467|ref|XP_001948906.2| PREDICTED: cytochrome P450 4C1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 61.6 bits (148), Expect = 6e-08, Method: Composition-based stats.
Identities = 33/78 (42%), Positives = 46/78 (58%), Gaps = 6/78 (7%)
Query: 13 ELYPQCFLPFMTGPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNF 72
E + ++PF TGPRNCIG KYA+LQMK ++VR LP + T Q +RL F
Sbjct: 377 ERHAYAYIPFSTGPRNCIGIKYAMLQMKTVASTLVRHHRFLPSDRCPTPDQ----LRLVF 432
Query: 73 --TLDLDEPCHIRLRERR 88
TL L + C++++ RR
Sbjct: 433 LTTLKLADGCYVKVEPRR 450
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195113985|ref|XP_002001548.1| GI21924 [Drosophila mojavensis] gi|193918142|gb|EDW17009.1| GI21924 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|195339523|ref|XP_002036369.1| GM12308 [Drosophila sechellia] gi|194130249|gb|EDW52292.1| GM12308 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|195577899|ref|XP_002078806.1| GD22340 [Drosophila simulans] gi|194190815|gb|EDX04391.1| GD22340 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|17647303|ref|NP_523527.1| cytochrome P450-4e3 [Drosophila melanogaster] gi|12643924|sp|Q9VL92.1|CP4E3_DROME RecName: Full=Cytochrome P450 4e3; AltName: Full=CYPIVE3 gi|7297550|gb|AAF52804.1| cytochrome P450-4e3 [Drosophila melanogaster] gi|157816420|gb|ABV82204.1| IP02904p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|443727452|gb|ELU14194.1| hypothetical protein CAPTEDRAFT_220559 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|66772683|gb|AAY55653.1| IP02804p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|189240567|ref|XP_001815543.1| PREDICTED: similar to cytochrome P450 monooxygenase [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|195147032|ref|XP_002014484.1| GL19213 [Drosophila persimilis] gi|194106437|gb|EDW28480.1| GL19213 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|198473596|ref|XP_001356361.2| GA17961 [Drosophila pseudoobscura pseudoobscura] gi|198138025|gb|EAL33424.2| GA17961 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 91 | ||||||
| FB|FBgn0015035 | 526 | Cyp4e3 "Cytochrome P450-4e3" [ | 0.560 | 0.096 | 0.471 | 7.5e-10 | |
| FB|FBgn0015033 | 463 | Cyp4d8 "Cytochrome P450-4d8" [ | 0.868 | 0.170 | 0.379 | 6.5e-08 | |
| FB|FBgn0014469 | 526 | Cyp4e2 "Cytochrome P450-4e2" [ | 0.560 | 0.096 | 0.462 | 6.9e-08 | |
| FB|FBgn0023541 | 507 | Cyp4d14 "Cyp4d14" [Drosophila | 0.593 | 0.106 | 0.472 | 7.5e-08 | |
| FB|FBgn0015034 | 531 | Cyp4e1 "Cytochrome P450-4e1" [ | 0.395 | 0.067 | 0.555 | 1.5e-07 | |
| FB|FBgn0015036 | 496 | Cyp4ae1 "Cytochrome P450-4ae1" | 0.483 | 0.088 | 0.477 | 1.5e-07 | |
| FB|FBgn0031694 | 511 | Cyp4ac2 "Cyp4ac2" [Drosophila | 0.604 | 0.107 | 0.446 | 1.6e-07 | |
| FB|FBgn0011576 | 501 | Cyp4d2 "Cytochrome P450-4d2" [ | 0.472 | 0.085 | 0.465 | 2.5e-07 | |
| FB|FBgn0031925 | 511 | Cyp4d21 "Cyp4d21" [Drosophila | 0.626 | 0.111 | 0.389 | 2.6e-07 | |
| FB|FBgn0033304 | 493 | Cyp6a13 "Cyp6a13" [Drosophila | 0.846 | 0.156 | 0.370 | 3.2e-07 |
| FB|FBgn0015035 Cyp4e3 "Cytochrome P450-4e3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 125 (49.1 bits), Expect = 7.5e-10, Sum P(2) = 7.5e-10
Identities = 25/53 (47%), Positives = 33/53 (62%)
Query: 2 YLPRGYRELKSELYPQCFLPFMTGPRNCIGGKYALLQMKVFTVSIVREFEILP 54
+ P + E K P +LPF GPRNCIG K+ALL++K +VR FE+LP
Sbjct: 418 FRPERFEEEKPA--PFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEVLP 468
|
|
| FB|FBgn0015033 Cyp4d8 "Cytochrome P450-4d8" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0014469 Cyp4e2 "Cytochrome P450-4e2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0023541 Cyp4d14 "Cyp4d14" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0015034 Cyp4e1 "Cytochrome P450-4e1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0015036 Cyp4ae1 "Cytochrome P450-4ae1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0031694 Cyp4ac2 "Cyp4ac2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0011576 Cyp4d2 "Cytochrome P450-4d2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0031925 Cyp4d21 "Cyp4d21" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033304 Cyp6a13 "Cyp6a13" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 91 | |||
| pfam00067 | 461 | pfam00067, p450, Cytochrome P450 | 4e-08 | |
| PLN02290 | 516 | PLN02290, PLN02290, cytokinin trans-hydroxylase | 2e-06 | |
| PLN02169 | 500 | PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla | 4e-06 | |
| PLN02426 | 502 | PLN02426, PLN02426, cytochrome P450, family 94, su | 5e-04 | |
| PLN00168 | 519 | PLN00168, PLN00168, Cytochrome P450; Provisional | 8e-04 | |
| PLN02738 | 633 | PLN02738, PLN02738, carotene beta-ring hydroxylase | 0.001 | |
| PLN03195 | 516 | PLN03195, PLN03195, fatty acid omega-hydroxylase; | 0.002 | |
| PTZ00404 | 482 | PTZ00404, PTZ00404, cytochrome P450; Provisional | 0.003 | |
| PLN02936 | 489 | PLN02936, PLN02936, epsilon-ring hydroxylase | 0.004 |
| >gnl|CDD|215689 pfam00067, p450, Cytochrome P450 | Back alignment and domain information |
|---|
Score = 48.4 bits (116), Expect = 4e-08
Identities = 16/38 (42%), Positives = 26/38 (68%)
Query: 19 FLPFMTGPRNCIGGKYALLQMKVFTVSIVREFEILPVE 56
FLPF GPRNC+G + A ++MK+F ++++ FE+
Sbjct: 400 FLPFGAGPRNCLGERLARMEMKLFLATLLQNFEVELPP 437
|
Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461 |
| >gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein | Back alignment and domain information |
|---|
| >gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 91 | |||
| KOG0157|consensus | 497 | 99.88 | ||
| KOG0158|consensus | 499 | 99.88 | ||
| KOG0159|consensus | 519 | 99.87 | ||
| PLN03195 | 516 | fatty acid omega-hydroxylase; Provisional | 99.87 | |
| PLN02169 | 500 | fatty acid (omega-1)-hydroxylase/midchain alkane h | 99.87 | |
| PLN02426 | 502 | cytochrome P450, family 94, subfamily C protein | 99.85 | |
| PLN02738 | 633 | carotene beta-ring hydroxylase | 99.85 | |
| PLN02936 | 489 | epsilon-ring hydroxylase | 99.84 | |
| PLN02290 | 516 | cytokinin trans-hydroxylase | 99.83 | |
| PLN00168 | 519 | Cytochrome P450; Provisional | 99.83 | |
| PLN03234 | 499 | cytochrome P450 83B1; Provisional | 99.83 | |
| PLN02655 | 466 | ent-kaurene oxidase | 99.83 | |
| PLN02394 | 503 | trans-cinnamate 4-monooxygenase | 99.82 | |
| PLN00110 | 504 | flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | 99.82 | |
| PF00067 | 463 | p450: Cytochrome P450 p450 superfamily signature b | 99.82 | |
| PLN03141 | 452 | 3-epi-6-deoxocathasterone 23-monooxygenase; Provis | 99.82 | |
| PTZ00404 | 482 | cytochrome P450; Provisional | 99.81 | |
| PLN02774 | 463 | brassinosteroid-6-oxidase | 99.81 | |
| PLN02183 | 516 | ferulate 5-hydroxylase | 99.81 | |
| PLN02302 | 490 | ent-kaurenoic acid oxidase | 99.81 | |
| PLN02687 | 517 | flavonoid 3'-monooxygenase | 99.8 | |
| PLN02987 | 472 | Cytochrome P450, family 90, subfamily A | 99.8 | |
| PLN02500 | 490 | cytochrome P450 90B1 | 99.8 | |
| PLN02971 | 543 | tryptophan N-hydroxylase | 99.79 | |
| PLN02196 | 463 | abscisic acid 8'-hydroxylase | 99.79 | |
| PLN03018 | 534 | homomethionine N-hydroxylase | 99.79 | |
| PLN03112 | 514 | cytochrome P450 family protein; Provisional | 99.78 | |
| PLN02966 | 502 | cytochrome P450 83A1 | 99.78 | |
| KOG0684|consensus | 486 | 99.77 | ||
| KOG0156|consensus | 489 | 99.76 | ||
| COG2124 | 411 | CypX Cytochrome P450 [Secondary metabolites biosyn | 99.54 | |
| PLN02648 | 480 | allene oxide synthase | 99.46 | |
| cd04518 | 174 | TBP_archaea archaeal TATA box binding protein (TBP | 89.27 | |
| COG2101 | 185 | SPT15 TATA-box binding protein (TBP), component of | 88.34 | |
| PLN00062 | 179 | TATA-box-binding protein; Provisional | 86.7 | |
| PRK00394 | 179 | transcription factor; Reviewed | 86.6 | |
| cd00652 | 174 | TBP_TLF TATA box binding protein (TBP): Present in | 85.61 | |
| cd04516 | 174 | TBP_eukaryotes eukaryotic TATA box binding protein | 83.99 | |
| PF00352 | 86 | TBP: Transcription factor TFIID (or TATA-binding p | 81.6 |
| >KOG0157|consensus | Back alignment and domain information |
|---|
Probab=99.88 E-value=1.5e-22 Score=130.78 Aligned_cols=82 Identities=34% Similarity=0.614 Sum_probs=71.5
Q ss_pred CccCCCCccccc--CcCCceeeecCCCCCCCcchHHHHHHHHHHHHHhhhccEEeecccccccccceeeEeeeEEEecCC
Q psy11243 1 MYLPRGYRELKS--ELYPQCFLPFMTGPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNFTLDLDE 78 (91)
Q Consensus 1 ~f~PeR~~~~~~--~~~~~~~~pFg~G~r~C~G~~~a~~~~~~~~~~l~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 78 (91)
+|+||||+++.. ..++++|+|||+|+|.|+|+.||++|++++++.++++|++.+..+ .. .......++.+++
T Consensus 413 ~F~PeRf~~~~~~~~~~~~~fipFsaGpR~CiG~~fA~lemKv~l~~ll~~f~~~~~~~-----~~-~~~~~~~~l~~~~ 486 (497)
T KOG0157|consen 413 EFDPERFLDGEEKAKRHPFAFIPFSAGPRNCIGQKFAMLEMKVVLAHLLRRFRIEPVGG-----DK-PKPVPELTLRPKN 486 (497)
T ss_pred hcCccccCCCCCcCCCCCccccCCCCCcccchhHHHHHHHHHHHHHHHHHheEEEecCC-----CC-ceeeeEEEEEecC
Confidence 599999995433 356799999999999999999999999999999999999998776 22 5567789999999
Q ss_pred CeeEEEEEcc
Q psy11243 79 PCHIRLRERR 88 (91)
Q Consensus 79 ~~~v~~~~r~ 88 (91)
+++|++.+|.
T Consensus 487 gl~v~~~~r~ 496 (497)
T KOG0157|consen 487 GLKVKLRPRG 496 (497)
T ss_pred CeEEEEEeCC
Confidence 9999999885
|
|
| >KOG0158|consensus | Back alignment and domain information |
|---|
| >KOG0159|consensus | Back alignment and domain information |
|---|
| >PLN03195 fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase | Back alignment and domain information |
|---|
| >PLN02426 cytochrome P450, family 94, subfamily C protein | Back alignment and domain information |
|---|
| >PLN02738 carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >PLN02936 epsilon-ring hydroxylase | Back alignment and domain information |
|---|
| >PLN02290 cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
| >PLN00168 Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PLN03234 cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
| >PLN02655 ent-kaurene oxidase | Back alignment and domain information |
|---|
| >PLN02394 trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | Back alignment and domain information |
|---|
| >PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry | Back alignment and domain information |
|---|
| >PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00404 cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PLN02774 brassinosteroid-6-oxidase | Back alignment and domain information |
|---|
| >PLN02183 ferulate 5-hydroxylase | Back alignment and domain information |
|---|
| >PLN02302 ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
| >PLN02687 flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
| >PLN02987 Cytochrome P450, family 90, subfamily A | Back alignment and domain information |
|---|
| >PLN02500 cytochrome P450 90B1 | Back alignment and domain information |
|---|
| >PLN02971 tryptophan N-hydroxylase | Back alignment and domain information |
|---|
| >PLN02196 abscisic acid 8'-hydroxylase | Back alignment and domain information |
|---|
| >PLN03018 homomethionine N-hydroxylase | Back alignment and domain information |
|---|
| >PLN03112 cytochrome P450 family protein; Provisional | Back alignment and domain information |
|---|
| >PLN02966 cytochrome P450 83A1 | Back alignment and domain information |
|---|
| >KOG0684|consensus | Back alignment and domain information |
|---|
| >KOG0156|consensus | Back alignment and domain information |
|---|
| >COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02648 allene oxide synthase | Back alignment and domain information |
|---|
| >cd04518 TBP_archaea archaeal TATA box binding protein (TBP): TBPs are transcription factors present in archaea and eukaryotes, that recognize promoters and initiate transcription | Back alignment and domain information |
|---|
| >COG2101 SPT15 TATA-box binding protein (TBP), component of TFIID and TFIIIB [Transcription] | Back alignment and domain information |
|---|
| >PLN00062 TATA-box-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK00394 transcription factor; Reviewed | Back alignment and domain information |
|---|
| >cd00652 TBP_TLF TATA box binding protein (TBP): Present in archaea and eukaryotes, TBPs are transcription factors that recognize promoters and initiate transcription | Back alignment and domain information |
|---|
| >cd04516 TBP_eukaryotes eukaryotic TATA box binding protein (TBP): Present in archaea and eukaryotes, TBPs are transcription factors that recognize promoters and initiate transcription | Back alignment and domain information |
|---|
| >PF00352 TBP: Transcription factor TFIID (or TATA-binding protein, TBP); InterPro: IPR000814 The TATA-box binding protein (TBP) is required for the initiation of transcription by RNA polymerases I, II and III, from promoters with or without a TATA box [, ] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 91 | ||||
| 1w0e_A | 485 | Crystal Structure Of Human Cytochrome P450 3a4 Leng | 4e-06 | ||
| 3ua1_A | 487 | Crystal Structure Of The Cytochrome P4503a4-Bromoer | 4e-06 | ||
| 1tqn_A | 486 | Crystal Structure Of Human Microsomal P450 3a4 Leng | 4e-06 | ||
| 1x8v_A | 455 | Estriol-Bound And Ligand-Free Structures Of Sterol | 3e-04 | ||
| 1u13_A | 455 | Crystal Structure Analysis Of The C37lC151TC442A-Tr | 3e-04 | ||
| 2w0a_A | 455 | Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( | 3e-04 | ||
| 1ea1_A | 455 | Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) | 4e-04 |
| >pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 | Back alignment and structure |
|
| >pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 | Back alignment and structure |
| >pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 | Back alignment and structure |
| >pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 | Back alignment and structure |
| >pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 | Back alignment and structure |
| >pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 | Back alignment and structure |
| >pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 91 | |||
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 3e-13 | |
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 6e-13 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 2e-11 | |
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 2e-11 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 5e-11 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 3e-10 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 5e-10 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 7e-10 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 9e-10 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 1e-09 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 1e-09 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 1e-09 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 2e-09 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 2e-09 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 1e-08 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 4e-08 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 2e-05 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 2e-04 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 3e-04 |
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 | Back alignment and structure |
|---|
Score = 62.0 bits (151), Expect = 3e-13
Identities = 20/77 (25%), Positives = 32/77 (41%), Gaps = 10/77 (12%)
Query: 16 PQCFLPFMTGPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNFTLD 75
+ F PF GPR C G A++ MK V+++R F + ++ Q E+I+ L
Sbjct: 424 YRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQ-----GQCVESIQKIHDLS 478
Query: 76 L-----DEPCHIRLRER 87
L + R
Sbjct: 479 LHPDETKNMLEMIFTPR 495
|
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 | Back alignment and structure |
|---|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 91 | |||
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 99.9 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 99.88 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 99.87 | |
| 3ld6_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 99.87 | |
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 99.86 | |
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 99.85 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 99.85 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 99.84 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 99.84 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 99.83 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 99.83 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 99.83 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 99.82 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 99.82 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 99.81 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 99.81 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 99.81 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 99.81 | |
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 99.8 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 99.8 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 99.8 | |
| 3v8d_A | 491 | Cholesterol 7-alpha-monooxygenase; cytochrome, oxi | 99.8 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 99.8 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 99.79 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 99.79 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 99.78 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 99.76 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 99.76 | |
| 1gwi_A | 411 | CYP154C1, cytochrome P450 154C1; oxidoreductase, m | 99.74 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 99.73 | |
| 4fb2_A | 398 | P450CIN; heme, monooxygenase, cindoxin, oxidoreduc | 99.72 | |
| 2dkk_A | 411 | Cytochrome P450; CYP158A1, INHI oxidoreductase; HE | 99.72 | |
| 3buj_A | 397 | CALO2; heme, iron, metal-binding, monooxygenase, o | 99.71 | |
| 2uuq_A | 414 | CYP130, cytochrome P450 130; iron, heme, monooxyge | 99.71 | |
| 3nc3_A | 441 | Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE | 99.71 | |
| 4dnj_A | 412 | Putative cytochrome P450; oxidoreductase; HET: HEM | 99.7 | |
| 3oft_A | 396 | Cytochrome P450, CYP101C1; oxidoreductase; HET: HE | 99.7 | |
| 2cd8_A | 436 | Cytochrome P450 monooxygenase; oxidoreductase, PIK | 99.7 | |
| 3a4g_A | 411 | Vitamin D hydroxylase; cytochrome P450, hemoprotei | 99.7 | |
| 1ued_A | 406 | P450 OXYC, P450 monooxygenase; cytochrome P450 van | 99.7 | |
| 3ejb_B | 404 | Biotin biosynthesis cytochrome P450-like enzyme; p | 99.69 | |
| 3aba_A | 403 | Cytochrome P450; oxidoreductase, heme, monooxygena | 99.69 | |
| 1odo_A | 408 | Putative cytochrome P450 154A1; P450 monooxygenase | 99.68 | |
| 1n40_A | 396 | P450 MT2, cytochrome P450 121; heme binding, oxyge | 99.68 | |
| 3oo3_A | 384 | OXY protein; cytochrome P450, monooxygenase, PCD-t | 99.68 | |
| 3abb_A | 408 | CYP105D6, cytochrome P450 hydroxylase; oxidoreduct | 99.67 | |
| 1s1f_A | 406 | Putative cytochrome P450; cytochrome P450 oxidored | 99.67 | |
| 2zwu_A | 415 | Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl | 99.67 | |
| 3lxh_A | 421 | Cytochrome P450; heme, iron, metal-binding, monoox | 99.67 | |
| 1cpt_A | 428 | Cytochrome P450-TERP; oxidoreductase(oxygenase); H | 99.66 | |
| 2z3t_A | 425 | Cytochrome P450; monoxygenase, oxydoreductase, hem | 99.66 | |
| 1jfb_A | 404 | Nitric-oxide reductase cytochrome P450 55A1; cytoc | 99.66 | |
| 2jjn_A | 411 | Cytochrome P450 113A1; oxidoreductase, iron, heme, | 99.65 | |
| 3rwl_A | 426 | Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 | 99.65 | |
| 1lfk_A | 398 | OXYB, P450 monooxygenase; oxidative phenol couplin | 99.65 | |
| 2y5n_A | 417 | MYCG, P-450-like protein; oxidoreductase, mycinami | 99.65 | |
| 1z8o_A | 404 | 6-deoxyerythronolide B hydroxylase; heme, CYP, ery | 99.65 | |
| 2xkr_A | 398 | CYP142, putative cytochrome P450 142; oxidoreducta | 99.65 | |
| 3mgx_A | 415 | Putative P450 monooxygenase; cytochrome P450 oxida | 99.64 | |
| 2xbk_A | 404 | PIMD protein; epoxidation, oxidoreductase; HET: HE | 99.64 | |
| 1q5d_A | 419 | P450 epoxidase; cytochrome P450, epothilone, oxydo | 99.64 | |
| 3ivy_A | 433 | Cytochrome P450 CYP125; cholesterol, monooxygenase | 99.62 | |
| 3tyw_A | 417 | Putative cytochrome P450; P450 monooxygenase, oxid | 99.62 | |
| 2wiy_A | 394 | XPLA-heme, cytochrome P450-like protein XPLA; CYT- | 99.62 | |
| 2zbx_A | 412 | Cytochrome P450-SU1; beta prism, heme, iron, metal | 99.61 | |
| 1io7_A | 368 | Cytochrome P450 CYP119; thermophilic, cytochromo P | 99.61 | |
| 3b4x_A | 367 | 367AA long hypothetical cytochrome P450; HEM prote | 99.6 | |
| 2z36_A | 413 | MOXA, cytochrome P450 type compactin 3'',4''- hydr | 99.6 | |
| 3r9b_A | 418 | Cytochrome P450 164A2; monooxygenase, oxidoreducta | 99.6 | |
| 4dxy_A | 417 | Cytochrome P450, CYP101D2; cytochrome P450 mutant, | 99.59 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 99.58 | |
| 2rfb_A | 343 | Cytochrome P450; heme, iron, metal-binding, monoox | 99.56 | |
| 3tkt_A | 450 | Cytochrome P450; aromatic hydrocarbon binding of P | 99.54 | |
| 2wm5_A | 435 | CYP124, putative cytochrome P450 124; metal-bindin | 99.53 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 99.52 | |
| 2yjn_B | 381 | Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; | 99.5 | |
| 3p3o_A | 416 | Cytochrome P450; monooxygenase, oxidoreductase; HE | 99.48 | |
| 1ais_A | 182 | TBP, protein (tata-binding protein); hyperthermoph | 86.08 | |
| 1ytb_A | 180 | Protein (tata binding protein (TBP)); protein-DNA | 85.49 | |
| 1mp9_A | 198 | Tata-binding protein; transcription regulation, DN | 83.99 | |
| 2z8u_A | 188 | Tata-box-binding protein; transcription, DNA-bindi | 83.6 | |
| 3eik_A | 218 | Tata-box-binding protein; DNA-binding, initiation | 80.12 |
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* | Back alignment and structure |
|---|
Probab=99.90 E-value=2e-24 Score=136.47 Aligned_cols=86 Identities=20% Similarity=0.433 Sum_probs=66.8
Q ss_pred CccCCCCcccccC-cCCceeeecCCCCCCCcchHHHHHHHHHHHHHhhhccEEeecccccccccceeeEeeeEEEecCCC
Q psy11243 1 MYLPRGYRELKSE-LYPQCFLPFMTGPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNFTLDLDEP 79 (91)
Q Consensus 1 ~f~PeR~~~~~~~-~~~~~~~pFg~G~r~C~G~~~a~~~~~~~~~~l~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 79 (91)
+|+||||++.+.. ..+.+|+|||+|+|+|+|++||.+|++++++.|+++|+++++++. ..........++..|+ +
T Consensus 392 ~F~PeRfl~~~~~~~~~~~~~pFG~G~R~C~G~~lA~~e~~~~la~ll~~f~~~~~~~~---~~~~~~~~~~~~~~P~-~ 467 (479)
T 3tbg_A 392 RFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQ---PRPSHHGVFAFLVSPS-P 467 (479)
T ss_dssp SCCGGGGBCTTCCBCCCTTCCTTCCSTTSCTTHHHHHHHHHHHHHHHHHHEEEECCTTS---CCCCSCEEESSSEEEC-C
T ss_pred ccCccccCCCCcccCCCCceecCCCCCcCChhHHHHHHHHHHHHHHHHHccEEEeCCCC---CCccccccceeeecCC-C
Confidence 6999999976543 567889999999999999999999999999999999999987651 1112223345566676 8
Q ss_pred eeEEEEEcccC
Q psy11243 80 CHIRLRERRRK 90 (91)
Q Consensus 80 ~~v~~~~r~~~ 90 (91)
++|.+++|++.
T Consensus 468 ~~v~~~pRs~~ 478 (479)
T 3tbg_A 468 YELCAVPRHHH 478 (479)
T ss_dssp CCBEEEEC---
T ss_pred eEEEEEECCCC
Confidence 99999999863
|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* | Back alignment and structure |
|---|
| >3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* | Back alignment and structure |
|---|
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* | Back alignment and structure |
|---|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... | Back alignment and structure |
|---|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* | Back alignment and structure |
|---|
| >3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* | Back alignment and structure |
|---|
| >1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* | Back alignment and structure |
|---|
| >4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* | Back alignment and structure |
|---|
| >2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* | Back alignment and structure |
|---|
| >3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* | Back alignment and structure |
|---|
| >3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* | Back alignment and structure |
|---|
| >4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* | Back alignment and structure |
|---|
| >3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* | Back alignment and structure |
|---|
| >2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* | Back alignment and structure |
|---|
| >3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* | Back alignment and structure |
|---|
| >1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* | Back alignment and structure |
|---|
| >3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* | Back alignment and structure |
|---|
| >1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* | Back alignment and structure |
|---|
| >3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* | Back alignment and structure |
|---|
| >3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* | Back alignment and structure |
|---|
| >2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... | Back alignment and structure |
|---|
| >3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* | Back alignment and structure |
|---|
| >1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* | Back alignment and structure |
|---|
| >1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* | Back alignment and structure |
|---|
| >2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* | Back alignment and structure |
|---|
| >3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} | Back alignment and structure |
|---|
| >1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* | Back alignment and structure |
|---|
| >2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* | Back alignment and structure |
|---|
| >1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* | Back alignment and structure |
|---|
| >2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} | Back alignment and structure |
|---|
| >2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* | Back alignment and structure |
|---|
| >1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* | Back alignment and structure |
|---|
| >3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* | Back alignment and structure |
|---|
| >3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* | Back alignment and structure |
|---|
| >2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* | Back alignment and structure |
|---|
| >2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* | Back alignment and structure |
|---|
| >1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* | Back alignment and structure |
|---|
| >3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* | Back alignment and structure |
|---|
| >2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} | Back alignment and structure |
|---|
| >3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* | Back alignment and structure |
|---|
| >4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* | Back alignment and structure |
|---|
| >2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* | Back alignment and structure |
|---|
| >3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* | Back alignment and structure |
|---|
| >2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* | Back alignment and structure |
|---|
| >1ais_A TBP, protein (tata-binding protein); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: d.129.1.1 d.129.1.1 PDB: 1d3u_A* 1pcz_A | Back alignment and structure |
|---|
| >1ytb_A Protein (tata binding protein (TBP)); protein-DNA complex, transcription/DNA complex; HET: DNA; 1.80A {Saccharomyces cerevisiae} SCOP: d.129.1.1 d.129.1.1 PDB: 1ngm_A* 1tba_B 1nh2_A* 1ytf_A* 1tbp_A 1qna_A* 1qn3_A* 1qn5_A* 1qn6_A* 1qn7_A* 1qn8_A* 1qn9_A* 1qn4_A* 1qnb_A* 1qnc_A* 1qne_A* 1vok_A 1vol_B* 1vto_A* 1vtl_E* ... | Back alignment and structure |
|---|
| >1mp9_A Tata-binding protein; transcription regulation, DNA-binding protein, transcription factor, DNA binding protein; 2.00A {Sulfolobus acidocaldarius} SCOP: d.129.1.1 d.129.1.1 | Back alignment and structure |
|---|
| >2z8u_A Tata-box-binding protein; transcription, DNA-binding protein, transcription factor, transcription regulation; 1.90A {Methanococcus jannaschii} | Back alignment and structure |
|---|
| >3eik_A Tata-box-binding protein; DNA-binding, initiation factor, nucleus, transcription; 1.90A {Encephalitozoon cuniculi} PDB: 3oci_A 3oc3_C | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 91 | ||||
| d1tqna_ | 472 | a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma | 8e-13 | |
| d2ciba1 | 445 | a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero | 4e-11 | |
| d1n97a_ | 385 | a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax | 5e-11 | |
| d2ij2a1 | 453 | a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus | 8e-10 | |
| d1r9oa_ | 467 | a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma | 2e-09 | |
| d1po5a_ | 465 | a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb | 3e-09 | |
| d3czha1 | 463 | a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 | 6e-09 | |
| d1ue8a_ | 367 | a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai | 6e-07 | |
| d1cpta_ | 428 | a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s | 1e-06 | |
| d1z8oa1 | 402 | a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo | 1e-06 | |
| d1odoa_ | 401 | a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce | 2e-06 | |
| d1gwia_ | 403 | a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce | 2e-06 | |
| d1izoa_ | 411 | a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba | 2e-06 | |
| d1jfba_ | 399 | a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta | 4e-06 | |
| d1q5da_ | 401 | a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell | 4e-06 | |
| d1io7a_ | 366 | a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata | 6e-06 | |
| d1n40a_ | 395 | a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My | 6e-06 | |
| d1lfka_ | 394 | a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops | 6e-06 | |
| d1s1fa_ | 399 | a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ | 7e-06 | |
| d1ueda_ | 403 | a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops | 1e-05 | |
| d1re9a_ | 404 | a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu | 5e-05 |
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cytochrome P450 superfamily: Cytochrome P450 family: Cytochrome P450 domain: Mammalian cytochrome P450 3a4 species: Human (Homo sapiens) [TaxId: 9606]
Score = 59.7 bits (143), Expect = 8e-13
Identities = 23/83 (27%), Positives = 44/83 (53%), Gaps = 4/83 (4%)
Query: 5 RGYRELKSELYPQCFLPFMTGPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQV 64
R ++ K + P + PF +GPRNCIG ++AL+ MK+ + +++ F P + Q+
Sbjct: 391 RFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKE----TQI 446
Query: 65 EEAIRLNFTLDLDEPCHIRLRER 87
+ L L ++P +++ R
Sbjct: 447 PLKLSLGGLLQPEKPVVLKVESR 469
|
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 | Back information, alignment and structure |
|---|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 | Back information, alignment and structure |
|---|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 | Back information, alignment and structure |
|---|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 | Back information, alignment and structure |
|---|
| >d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 | Back information, alignment and structure |
|---|
| >d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 | Back information, alignment and structure |
|---|
| >d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 91 | |||
| d1tqna_ | 472 | Mammalian cytochrome P450 3a4 {Human (Homo sapiens | 99.89 | |
| d3czha1 | 463 | Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie | 99.88 | |
| d2ciba1 | 445 | Cytochrome p450 14 alpha-sterol demethylase (cyp51 | 99.87 | |
| d1r9oa_ | 467 | Mammalian cytochrome p450 2c9 {Human (Homo sapiens | 99.87 | |
| d2ij2a1 | 453 | Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: | 99.86 | |
| d1po5a_ | 465 | Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus | 99.85 | |
| d1n97a_ | 385 | Cyp175a1 {Thermus thermophilus [TaxId: 274]} | 99.83 | |
| d1izoa_ | 411 | Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis | 99.8 | |
| d1odoa_ | 401 | Cyp154a1 monooxygenase {Streptomyces coelicolor [T | 99.78 | |
| d1cpta_ | 428 | Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] | 99.74 | |
| d1gwia_ | 403 | Cyp154c1 monooxygenase {Streptomyces coelicolor [T | 99.74 | |
| d1z8oa1 | 402 | Cytochrome P450-ERYF {Saccharopolyspora erythraea | 99.73 | |
| d1q5da_ | 401 | Cytochrome P450epok {Sorangium cellulosum [TaxId: | 99.72 | |
| d1jfba_ | 399 | Cytochrome P450-NOR, nitric reductase {Fungus (Fus | 99.68 | |
| d1ueda_ | 403 | p450 monoxygenase OxyC {Amycolatopsis orientalis [ | 99.68 | |
| d1s1fa_ | 399 | Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | 99.65 | |
| d1lfka_ | 394 | p450 monoxygenase OxyB {Amycolatopsis orientalis [ | 99.64 | |
| d1ue8a_ | 367 | Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 | 99.64 | |
| d1io7a_ | 366 | Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 | 99.63 | |
| d1re9a_ | 404 | Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 | 99.57 | |
| d1n40a_ | 395 | Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub | 99.55 | |
| d1aisa1 | 92 | TATA-box binding protein (TBP), C-terminal domain | 93.52 | |
| d1mp9a1 | 92 | TATA-box binding protein (TBP), C-terminal domain | 93.48 | |
| d1aisa2 | 89 | TATA-box binding protein (TBP), C-terminal domain | 92.59 | |
| d1qnaa1 | 99 | TATA-box binding protein (TBP), C-terminal domain | 92.08 | |
| d1qnaa2 | 83 | TATA-box binding protein (TBP), C-terminal domain | 91.7 | |
| d1mp9a2 | 101 | TATA-box binding protein (TBP), C-terminal domain | 89.84 |
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cytochrome P450 superfamily: Cytochrome P450 family: Cytochrome P450 domain: Mammalian cytochrome P450 3a4 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.89 E-value=2.2e-24 Score=134.05 Aligned_cols=85 Identities=27% Similarity=0.627 Sum_probs=70.2
Q ss_pred CccCCCCcccccC-cCCceeeecCCCCCCCcchHHHHHHHHHHHHHhhhccEEeecccccccccceeeEeeeEEEecCCC
Q psy11243 1 MYLPRGYRELKSE-LYPQCFLPFMTGPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNFTLDLDEP 79 (91)
Q Consensus 1 ~f~PeR~~~~~~~-~~~~~~~pFg~G~r~C~G~~~a~~~~~~~~~~l~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 79 (91)
+|+||||++.+.. ..+..++|||+|+|.|+|+++|.++++++++.|+++|++++.++ ...+........+.|+++
T Consensus 386 ~F~PeRfl~~~~~~~~~~~~~~FG~G~r~C~G~~~A~~~~~~~la~ll~~f~~~~~~~----~~~~~~~~~~~~~~p~~~ 461 (472)
T d1tqna_ 386 KFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKE----TQIPLKLSLGGLLQPEKP 461 (472)
T ss_dssp SCCGGGGSTTTGGGCCTTTSCTTCCSTTSCTTHHHHHHHHHHHHHHHHTTEEEECCTT----CCSSCCBCSSSSCCBSSC
T ss_pred ccCccccCCCCcccCCCceecCCCCCCccChhHHHHHHHHHHHHHHHHHhCEEEeCCC----CCCCceeccceEEeeCCC
Confidence 6999999976543 56778999999999999999999999999999999999998765 122333444566788889
Q ss_pred eeEEEEEccc
Q psy11243 80 CHIRLRERRR 89 (91)
Q Consensus 80 ~~v~~~~r~~ 89 (91)
+.|++++|+.
T Consensus 462 ~~~~~~~R~~ 471 (472)
T d1tqna_ 462 VVLKVESRDG 471 (472)
T ss_dssp CEEEEEETTC
T ss_pred EEEEEEECCC
Confidence 9999999975
|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1aisa1 d.129.1.1 (A:1-92) TATA-box binding protein (TBP), C-terminal domain {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1mp9a1 d.129.1.1 (A:5-96) TATA-box binding protein (TBP), C-terminal domain {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1aisa2 d.129.1.1 (A:93-181) TATA-box binding protein (TBP), C-terminal domain {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1qnaa1 d.129.1.1 (A:17-115) TATA-box binding protein (TBP), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1qnaa2 d.129.1.1 (A:116-198) TATA-box binding protein (TBP), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1mp9a2 d.129.1.1 (A:97-197) TATA-box binding protein (TBP), C-terminal domain {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|