Diaphorina citri psyllid: psy11246


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MEKKDLQAEIESHKDVYSSLNTSGKRLLGSLTSQDDAVMLQRRLDEMNQRWHHLKNRSLAIRMQSLIFYSLSVTLQPGIQYPIDTLAFTTLSDITSLIWYK
ccHHHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEECcccccccccHHHHHHHccHHHHHccc
****DLQAEIESHKDVYSS********************LQRRLDEMNQRWHHLKNRSLAIRMQSLIFYSLSVTLQPGIQYPIDTLAFTTLSDITSLIWYK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MExxxxxxxxxxxxxxxxxxxxxGKRLLGSLTSQDDAVMLQRRLDEMNQRWHHLKNRSLAIRMQSLIFYSLSVTLQPGIQYPIDTLAFTTLSDITSLIWYK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dystrophin, isoform B Required for the maintenance of appropriate synaptic retrograde communication and the stabilization of muscle cell architecture or physiology. May play a role in anchoring the cytoskeleton to the plasma membrane.confidentQ9VDW3
Dystrophin Anchors the extracellular matrix to the cytoskeleton via F-actin. Ligand for dystroglycan. Component of the dystrophin-associated glycoprotein complex which accumulates at the neuromuscular junction (NMJ) and at a variety of synapses in the peripheral and central nervous systems and has a structural function in stabilizing the sarcolemma. Also implicated in signaling events and synaptic transmission.confidentP11531
Dystrophin Anchors the extracellular matrix to the cytoskeleton via F-actin. Ligand for dystroglycan. Component of the dystrophin-associated glycoprotein complex which accumulates at the neuromuscular junction (NMJ) and at a variety of synapses in the peripheral and central nervous systems and has a structural function in stabilizing the sarcolemma. Also implicated in signaling events and synaptic transmission.confidentO97592

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007274 [BP]neuromuscular synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007268, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0046928 [BP]regulation of neurotransmitter secretionprobableGO:0032879, GO:0051046, GO:0060341, GO:0010646, GO:0051049, GO:0050794, GO:0008150, GO:0031644, GO:0044057, GO:0065007, GO:0051239, GO:0023051, GO:0051588, GO:0051969, GO:0050804, GO:0050789
GO:0048172 [BP]regulation of short-term neuronal synaptic plasticityprobableGO:0010646, GO:0044057, GO:0031644, GO:0050804, GO:0050789, GO:0048167, GO:0065007, GO:0051239, GO:0023051, GO:0008150, GO:0051969, GO:0065008, GO:0048168, GO:0050794
GO:0030175 [CC]filopodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0003779 [MF]actin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0007474 [BP]imaginal disc-derived wing vein specificationprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0003002, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0046716 [BP]muscle cell homeostasisprobableGO:0019725, GO:0060249, GO:0009987, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0065008, GO:0044699
GO:0045202 [CC]synapseprobableGO:0005575
GO:0044306 [CC]neuron projection terminusprobableGO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030055 [CC]cell-substrate junctionprobableGO:0005575, GO:0030054
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0017022 [MF]myosin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0030010 [BP]establishment of cell polarityprobableGO:0008150, GO:0009987, GO:0007163, GO:0044763, GO:0044699
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0008586 [BP]imaginal disc-derived wing vein morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0043043 [BP]peptide biosynthetic processprobableGO:0071704, GO:0043604, GO:0044271, GO:1901566, GO:0043603, GO:1901576, GO:0009987, GO:0034641, GO:0044237, GO:0044249, GO:0009058, GO:0006807, GO:0008150, GO:0008152, GO:1901564, GO:0006518
GO:0043034 [CC]costamereprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0050699 [MF]WW domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0042383 [CC]sarcolemmaprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886
GO:0005198 [MF]structural molecule activityprobableGO:0003674

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1U5P, chain A
Confidence level:very confident
Coverage over the Query: 3-89
View the alignment between query and template
View the model in PyMOL