Diaphorina citri psyllid: psy11267


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MIGVEGGHSLGNSMAVLRMFYKLGVRYLTLTHACPTPWYLVVRECNRLGMLIDLSHTSVQTMRHVLNISSAPVIFSHSSAFALCPSPRNVPDPVLKLVFPYLT
cccccccccccccHHHHHHHHHccccEEEcccccccccHHHHHHHHHcccEEEcccccHHHHHHHHHHccccCEECcccccccccccccccHHHHHHHccccc
MIGVEGGHSLGNSMAVLRMFYKLGVRYLTLTHACPTPWYLVVRECNRLGMLIDLSHTSVQTMRHVLNISSAPVIFSHSSAFALCPSPRNVPDPVLKLVFPY**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIGVEGGHSLGNSMAVLRMFYKLGVRYLTLTHACPTPWYLVVRECNRLGMLIDLSHTSVQTMRHVLNISSAPVIFSHSSAFALCPSPRNVPDPVLKLVFPYLT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dipeptidase 2 Probable metalloprotease which hydrolyzes leukotriene D4 (LTD4) into leukotriene E4 (LTE4).confidentQ8C255
Dipeptidase 1 Hydrolyzes a wide range of dipeptides. Implicated in the renal metabolism of glutathione and its conjugates. Converts leukotriene D4 to leukotriene E4; it may play an important role in the regulation of leukotriene activity.confidentP31428
Dipeptidase 1 Hydrolyzes a wide range of dipeptides. Implicated in the renal metabolism of glutathione and its conjugates. Converts leukotriene D4 to leukotriene E4; it may play an important role in the regulation of leukotriene activity.confidentP16444

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0016999 [BP]antibiotic metabolic processprobableGO:0009987, GO:0017144, GO:0008150, GO:0008152, GO:0044237
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0071732 [BP]cellular response to nitric oxideprobableGO:0071241, GO:0000302, GO:0070887, GO:0044699, GO:0051716, GO:1902170, GO:0009987, GO:0034614, GO:0006950, GO:0044763, GO:0042221, GO:0034599, GO:0010035, GO:0006979, GO:1901700, GO:1901701, GO:0071731, GO:1901698, GO:1901699, GO:0033554, GO:0008150, GO:0050896
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0043027 [MF]cysteine-type endopeptidase inhibitor activity involved in apoptotic processprobableGO:0004866, GO:0030234, GO:0061134, GO:0043028, GO:0003674, GO:0030414, GO:0004869, GO:0004857, GO:0061135
GO:0071277 [BP]cellular response to calcium ionprobableGO:0051716, GO:0071248, GO:0010038, GO:0050896, GO:0009987, GO:0071241, GO:0051592, GO:0044763, GO:0008150, GO:0070887, GO:0042221, GO:0010035, GO:0044699
GO:0043154 [BP]negative regulation of cysteine-type endopeptidase activity involved in apoptotic processprobableGO:0019222, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0044699, GO:0051346, GO:2000116, GO:2000117, GO:0043086, GO:0043067, GO:0010466, GO:0065007, GO:0044092, GO:0043281, GO:0065009, GO:0010259, GO:0006915, GO:0052547, GO:0052548, GO:0009987, GO:0050794, GO:0012501, GO:0044763, GO:0010951, GO:0051336, GO:0050790, GO:0008150
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0070573 [MF]metallodipeptidase activityprobableGO:0016787, GO:0003824, GO:0016805, GO:0008238, GO:0070011, GO:0003674, GO:0008233, GO:0008235, GO:0008237
GO:0072341 [MF]modified amino acid bindingprobableGO:0043168, GO:0031406, GO:0043167, GO:0003674, GO:0005488, GO:0016597
GO:0035690 [BP]cellular response to drugprobableGO:0051716, GO:0050896, GO:0009987, GO:0042493, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0044699
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0034235 [MF]GPI anchor bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:0051861
GO:0032869 [BP]cellular response to insulin stimulusprobableGO:0070887, GO:0032868, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:0071417, GO:0071310, GO:0071495, GO:0009987, GO:0032870, GO:0044763, GO:0010243, GO:0042221, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0050896, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:1901698
GO:0050667 [BP]homocysteine metabolic processprobableGO:0044238, GO:0044710, GO:0000096, GO:1901564, GO:0006575, GO:0006082, GO:0006520, GO:0044237, GO:0071704, GO:0006807, GO:0006790, GO:0019752, GO:0008152, GO:0043436, GO:0008150, GO:0009987, GO:1901605, GO:0044281
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0030336 [BP]negative regulation of cell migrationprobableGO:0040013, GO:0051270, GO:0065007, GO:0051271, GO:0040012, GO:0008150, GO:0030334, GO:2000145, GO:2000146, GO:0048519, GO:0032879, GO:0050794, GO:0050789, GO:0048523
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0006507 [BP]GPI anchor releaseprobableGO:0044238, GO:0006644, GO:0009987, GO:0006643, GO:1901135, GO:0006629, GO:0044710, GO:0044237, GO:0008150, GO:0071704, GO:0006796, GO:0046488, GO:0008152, GO:0006793, GO:0019637, GO:0006505, GO:0046486, GO:0006664, GO:0044255, GO:0006650

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ID7, chain A
Confidence level:very confident
Coverage over the Query: 1-101
View the alignment between query and template
View the model in PyMOL