Diaphorina citri psyllid: psy11283

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----
MNFVGRMYYSYNDVDHLMRVRGQIDSMRAIALQGGGTKSIQAQHNKGKLTARERVELLCDPGTFVEYDMFMEHRCVDFNMSEKKIPGDSVVTGRGSVNGRTVFIFSQDFTVFGGSLSSVHAEKICKIMDQAMLTGAPIVGLNDSGGARIQEGVESLAAYSSVFQRNILASGVVPQISLILGPCAGGAVYSPAITDFTFMVEHSSYLFITGPDVIKSVTNEDISQEELGGAKTHTSVSGVAHNAFSNDIDAIQNVRHLLGFLPMNNTQKPPIRRCYDSREFFEIQPKYAKNIIVGFARINGHSVGIVANQPKVAA
cccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHcccccccccccccccccccccccccccccccEEEEEEEEEccEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccccccccEEEEEcccCEEEECcccHHHHcccccccccccccHHHHcccccccCEEcccHHHHHHHHHHHHcccccccccccccEEccccccccccccccccccEEEEEEEccEEEEEEcccccccc
**FVGRMYYSYNDVDHLMRVRGQIDSMRAIALQGG***********GKLTARERVELLCDPGTFVEYDMFMEHRCVDFNMSEKKIPGDSVVTGRGSVNGRTVFIFSQDFTVFGGSLSSVHAEKICKIMDQAMLTGAPIVGLNDSGGARIQEGVESLAAYSSVFQRNILASGVVPQISLILGPCAGGAVYSPAITDFTFMVEHSSYLFITGPDVIKSVTNEDISQEELGGAKTHTSVSGVAHNAFSNDIDAIQNVRHLLGFLPMNNTQKPPIRRCYDSREFFEIQPKYAKNIIVGFARINGHSVGIVANQPKV**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNFVGRMYYSYNDVDHLMRVRGQIDSMRAIALQGGGTKSIQAQHNKGKLTARERVELLCDPGTFVEYDMFMEHRCVDFNMSEKKIPGDSVVTGRGSVNGRTVFIFSQDFTVFGGSLSSVHAEKICKIMDQAMLTGAPIVGLNDSGGARIQEGVESLAAYSSVFQRNILASGVVPQISLILGPCAGGAVYSPAITDFTFMVEHSSYLFITGPDVIKSVTNEDISQEELGGAKTHTSVSGVAHNAFSNDIDAIQNVRHLLGFLPMNNTQKPPIRRCYDSREFFEIQPKYAKNIIVGFARINGHSVGIVANQPKVAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Propionyl-CoA carboxylase beta chain confidentP53003
Propionyl-CoA carboxylase beta chain, mitochondrial confidentQ2TBR0
Propionyl-CoA carboxylase beta chain, mitochondrial confidentP05166

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004658 [MF]propionyl-CoA carboxylase activityprobableGO:0016874, GO:0003674, GO:0016885, GO:0016421, GO:0003824
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0006633 [BP]fatty acid biosynthetic processprobableGO:0006631, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237
GO:0009317 [CC]acetyl-CoA carboxylase complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0015977 [BP]carbon fixationprobableGO:0071704, GO:0044710, GO:0008150, GO:0008152
GO:0003989 [MF]acetyl-CoA carboxylase activityprobableGO:0016874, GO:0003674, GO:0016885, GO:0016421, GO:0003824
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3N6R, chain B
Confidence level:very confident
Coverage over the Query: 21-313
View the alignment between query and template
View the model in PyMOL