Diaphorina citri psyllid: psy11285


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
SGIYLKSCLDSWYGCCPDNKTLAQGPDNAGCPSTCGCNKLGSTEDACIEDTEQCKCKQGVGGLKCDRCEPGYWGLSKISSYAPDIDGCLKCGCSQFGSVREDCEQMTGRCVCKPGVKGSKCNECLDPNKKLGPNGCMPGMEVKPCNGEPPVINLQTGVELDCGSGANREDCPSDAYCHITQNFARCCRK
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCCccccccccccccccccccccccccccccc
SGIYLKSCLDSWYGCCPDNKTLAQGPDNAGCPSTCGCNKLGSTEDACIEDTEQCKCKQGVGGLKCDRCEPGYWGLSKISSYAPDIDGCLKCGCSQFGSVREDCEQMTGRCVCKPGVKGSKCNECLDPNKKLGPNGCMPGMEVKPCNGEPPVINLQTGVELDCGSGANREDCPSDAYCHITQNFARCCR*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SGIYLKSCLDSWYGCCPDNKTLAQGPDNAGCPSTCGCNKLGSTEDACIEDTEQCKCKQGVGGLKCDRCEPGYWGLSKISSYAPDIDGCLKCGCSQFGSVREDCEQMTGRCVCKPGVKGSKCNECLDPNKKLGPNGCMPGMEVKPCNGEPPVINLQTGVELDCGSGANREDCPSDAYCHITQNFARCCRK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Agrin Plays a central role in the formation and the maintenance of the neuromuscular junction (NMJ), the synapse between motor neuron and skeletal muscle. Ligand of the MUSK signaling complex that directly binds LRP4 in this complex and induces the phosphorylation of MUSK, the kinase of the complex. The activation of MUSK in myotubes induces the formation of NMJ by regulating different processes including the transcription of specific genes and the clustering of AChR in the postsynaptic membrane.confidentO00468
Agrin Plays a central role in the formation and the maintenance of the neuromuscular junction (NMJ), the synapse between motor neuron and skeletal muscle. Ligand of the MUSK signaling complex that induces the phosphorylation of MUSK, the kinase of the complex. The activation of MUSK in myotubes induces the formation of NMJ by regulating different processes including the transcription of specific genes and the clustering of AChR in the postsynaptic membrane.confidentP31696

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043208 [MF]glycosphingolipid bindingprobableGO:0005488, GO:0003674, GO:0046625, GO:0008289, GO:0051861
GO:0044422 [CC]organelle partprobableGO:0005575, GO:0043226
GO:0050790 [BP]regulation of catalytic activityprobableGO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0046578 [BP]regulation of Ras protein signal transductionprobableGO:0051056, GO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0031226 [CC]intrinsic to plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0005198 [MF]structural molecule activityprobableGO:0003674
GO:0007409 [BP]axonogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0005610 [CC]laminin-5 complexprobableGO:0043234, GO:0005605, GO:0005604, GO:0032991, GO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0043256, GO:0044420, GO:0044421
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0070062 [CC]extracellular vesicular exosomeprobableGO:0043230, GO:0031982, GO:0044421, GO:0065010, GO:0031988, GO:0005575, GO:0005576, GO:0043227, GO:0043226
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0034446 [BP]substrate adhesion-dependent cell spreadingprobableGO:0032502, GO:0031589, GO:0000904, GO:0000902, GO:0009653, GO:0048869, GO:0030154, GO:0048468, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0007155, GO:0008150, GO:0009987, GO:0022610, GO:0044699, GO:0048856
GO:0007166 [BP]cell surface receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0001932 [BP]regulation of protein phosphorylationprobableGO:0042325, GO:0032268, GO:0019220, GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0051246, GO:0050794, GO:0051174, GO:0065007, GO:0031399, GO:0008150, GO:0050789
GO:0051179 [BP]localizationprobableGO:0008150
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AQS, chain A
Confidence level:very confident
Coverage over the Query: 2-124
View the alignment between query and template
View the model in PyMOL
Template: 1KLO, chain A
Confidence level:very confident
Coverage over the Query: 35-189
View the alignment between query and template
View the model in PyMOL