Psyllid ID: psy11285

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
SGIYLKSCLDSWYGCCPDNKTLAQGPDNAGCPSTCGCNKLGSTEDACIEDTEQCKCKQGVGGLKCDRCEPGYWGLSKISSYAPDIDGCLKCGCSQFGSVREDCEQMTGRCVCKPGVKGSKCNECLDPNKKLGPNGCMPGMEVKPCNGEPPVINLQTGVELDCGSGANREDCPSDAYCHITQNFARCCRK
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccc
cccccHccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
sgiylkscldswygccpdnktlaqgpdnagcpstcgcnklgstedaciedteqckckqgvgglkcdrcepgywglskissyapdidgclkcgcsqfgsvredceqmtgrcvckpgvkgskcnecldpnkklgpngcmpgmevkpcngeppvinlqtgveldcgsganredcpsdaychitqnfarccrk
SGIYLKSCLDSWYGCCPDNKTLAQGPDNAGCPSTCGCNKLGSTEDACIEDTEQckckqgvgglkcdrCEPGYWGLSKISSYAPDIDGCLKCGCSQFGSVREDCEQMTGRcvckpgvkgskcnecldpnkklgpnGCMPGMEVKPCNGEPPVINLQTGVELDCGSGANREDCPSDAYCHITQnfarccrk
SGIYLKSCLDSWYGCCPDNKTLAQGPDNAGCPSTCGCNKLGSTEDACIEDTEQCKCKQGVGGLKCDRCEPGYWGLSKISSYAPDIDGCLKCGCSQFGSVREDCEQMTGRCVCKPGVKGSKCNECLDPNKKLGPNGCMPGMEVKPCNGEPPVINLQTGVELDCGSGANREDCPSDAYCHITQNFARCCRK
**IYLKSCLDSWYGCCPDNKTLAQGPDNAGCPSTCGCNKLGSTEDACIEDTEQCKCKQGVGGLKCDRCEPGYWGLSKISSYAPDIDGCLKCGCSQFGSVREDCEQMTGRCVCKPGVKGSKCNECLD******************C***PPVINLQTGVELDCGSGANREDCPSDAYCHITQNFARCC**
SGIYLKSCLDSWYGCCPDNKTLAQGPDNAGCPSTCGCNKLGSTEDACIEDTEQCKCKQGVGGLKCDRCEPGYWGLSKISSYAPDIDGCLKCGCSQFGSVREDCEQMTGRCVCKPGVKGSKCNECLDPNKKLGPNGCMPGMEVKPCNGEPPVINLQTGVELDCGSGANREDCPSDAYCHITQNFARCCR*
SGIYLKSCLDSWYGCCPDNKTLAQGPDNAGCPSTCGCNKLGSTEDACIEDTEQCKCKQGVGGLKCDRCEPGYWGLSKISSYAPDIDGCLKCGCSQFGSVREDCEQMTGRCVCKPGVKGSKCNECLDPNKKLGPNGCMPGMEVKPCNGEPPVINLQTGVELDCGSGANREDCPSDAYCHITQNFARCCRK
****LKSCLDSWYGCCPD****AQGPDNAGCPSTCGCNKLGSTEDACIEDTEQCKCKQGVGGLKCDRCEPGYWGLSKISSYAPDIDGCLKCGCSQFGSVREDCEQMTGRCVCKPGVKGSKCNECLDPNKKLGPNGCMPGMEVKPCNGEPPVINLQTGVELDCGSGANREDCPSDAYCHITQNF******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SGIYLKSCLDSWYGCCPDNKTLAQGPDNAGCPSTCGCNKLGSTEDACIEDTEQCKCKQGVGGLKCDRCEPGYWGLSKISSYAPDIDGCLKCGCSQFGSVREDCEQMTGRCVCKPGVKGSKCNECLDPNKKLGPNGCMPGMEVKPCNGEPPVINLQTGVELDCGSGANREDCPSDAYCHITQNFARCCRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query189 2.2.26 [Sep-21-2011]
Q90404 1328 Agrin (Fragment) OS=Diplo N/A N/A 0.661 0.094 0.561 2e-30
P31696 2081 Agrin OS=Gallus gallus GN yes N/A 0.677 0.061 0.556 6e-30
P25304 1959 Agrin OS=Rattus norvegicu yes N/A 0.798 0.077 0.478 3e-28
O00468 2067 Agrin OS=Homo sapiens GN= yes N/A 0.666 0.060 0.534 3e-28
A2ASQ1 1950 Agrin OS=Mus musculus GN= yes N/A 0.772 0.074 0.493 5e-28
Q9Y6N6 1575 Laminin subunit gamma-3 O no N/A 0.444 0.053 0.440 4e-13
Q1LVF0 1593 Laminin subunit gamma-1 O no N/A 0.486 0.057 0.441 4e-12
P11046 1788 Laminin subunit beta-1 OS yes N/A 0.518 0.054 0.390 1e-11
P24043 3122 Laminin subunit alpha-2 O no N/A 0.624 0.037 0.345 2e-11
Q9R0B6 1581 Laminin subunit gamma-3 O no N/A 0.444 0.053 0.419 2e-11
>sp|Q90404|AGRIN_DIPOM Agrin (Fragment) OS=Diplobatis ommata GN=AGRN PE=2 SV=1 Back     alignment and function desciption
 Score =  132 bits (331), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 84/130 (64%), Gaps = 5/130 (3%)

Query: 8   CLDSWYGCCPDNKTLAQGPDNAGCPSTCGCNKLGSTEDACIEDTEQCKCKQGVGGLKCDR 67
           C  S YGCC DN T AQG   AGCPSTC CN+ GS    C   + QC CK GVGGLKCDR
Sbjct: 52  CSRSVYGCCRDNVTAAQGVGLAGCPSTCECNRYGSYSKTCSPSSGQCSCKPGVGGLKCDR 111

Query: 68  CEPGYWGLSKISSYAPDIDGCLKCGCSQFGSVREDCEQMTGRCVCKPGVKGSKCNECLDP 127
           CEPG+W    I +   +  GC  C C   G+VR+DCEQM+G C CK G+ G KCN+C  P
Sbjct: 112 CEPGFWNFRGIVT--DEKSGCTPCNCYPLGAVRDDCEQMSGLCSCKAGISGMKCNQC--P 167

Query: 128 N-KKLGPNGC 136
           N  KLGP+GC
Sbjct: 168 NGSKLGPSGC 177
Plays a central role in the formation and the maintenance of the neuromuscular junction (NMJ), the synapse between motor neuron and skeletal muscle. Ligand of the MUSK signaling complex that induces the phosphorylation of MUSK, the kinase of the complex. The activation of MUSK in myotubes induces the formation of NMJ by regulating different processes including the transcription of specific genes and the clustering of AChR in the postsynaptic membrane.
Discopyge ommata (taxid: 7785)
>sp|P31696|AGRIN_CHICK Agrin OS=Gallus gallus GN=AGRN PE=1 SV=3 Back     alignment and function description
>sp|P25304|AGRIN_RAT Agrin OS=Rattus norvegicus GN=Agrn PE=1 SV=2 Back     alignment and function description
>sp|O00468|AGRIN_HUMAN Agrin OS=Homo sapiens GN=AGRN PE=1 SV=5 Back     alignment and function description
>sp|A2ASQ1|AGRIN_MOUSE Agrin OS=Mus musculus GN=Agrn PE=1 SV=1 Back     alignment and function description
>sp|Q9Y6N6|LAMC3_HUMAN Laminin subunit gamma-3 OS=Homo sapiens GN=LAMC3 PE=1 SV=3 Back     alignment and function description
>sp|Q1LVF0|LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio GN=lamc1 PE=2 SV=2 Back     alignment and function description
>sp|P11046|LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melanogaster GN=LanB1 PE=1 SV=4 Back     alignment and function description
>sp|P24043|LAMA2_HUMAN Laminin subunit alpha-2 OS=Homo sapiens GN=LAMA2 PE=1 SV=4 Back     alignment and function description
>sp|Q9R0B6|LAMC3_MOUSE Laminin subunit gamma-3 OS=Mus musculus GN=Lamc3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
189233617 2027 PREDICTED: similar to agrin [Tribolium c 0.693 0.064 0.694 3e-46
270014663 1796 hypothetical protein TcasGA2_TC004709 [T 0.693 0.072 0.694 5e-46
307213743 780 Agrin [Harpegnathos saltator] 0.835 0.202 0.590 8e-44
242020688 1614 Agrin precursor, putative [Pediculus hum 0.698 0.081 0.674 1e-43
340723263 2243 PREDICTED: agrin-like [Bombus terrestris 0.740 0.062 0.622 3e-42
350425393 2243 PREDICTED: agrin-like [Bombus impatiens] 0.740 0.062 0.622 3e-42
307179324 1668 Agrin [Camponotus floridanus] 0.740 0.083 0.622 4e-42
332020061 713 Agrin [Acromyrmex echinatior] 0.772 0.204 0.598 5e-42
322800543282 hypothetical protein SINV_00404 [Solenop 0.746 0.5 0.631 1e-41
328787536 1900 PREDICTED: agrin-like isoform 1 [Apis me 0.740 0.073 0.615 3e-41
>gi|189233617|ref|XP_001811978.1| PREDICTED: similar to agrin [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 105/134 (78%), Gaps = 3/134 (2%)

Query: 6    KSCLDSWYGCCPDNKTLAQGPDNAGCPSTCGCNKLGSTEDACIEDTEQCKCKQGVGGLKC 65
            KSC DSW+GCCPD KT AQGP++AGCPS CGCNKLGS  D C  +T+QC+C+ GVGG KC
Sbjct: 899  KSCEDSWHGCCPDGKTAAQGPNHAGCPSLCGCNKLGSYSDTCDPETQQCRCRPGVGGAKC 958

Query: 66   DRCEPGYWGLSKISSYAPDIDGCLKCGCSQFGSVREDCEQMTGRCVCKPGVKGSKCNECL 125
            DRCEPGYWGL KISS      GC+ CGCS FGSVR+DCEQMTGRCVC PGV+G KC  C 
Sbjct: 959  DRCEPGYWGLPKISS---GYHGCIPCGCSTFGSVRDDCEQMTGRCVCNPGVQGQKCTVCT 1015

Query: 126  DPNKKLGPNGCMPG 139
              +K LGPNGC+P 
Sbjct: 1016 SHDKVLGPNGCVPA 1029

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270014663|gb|EFA11111.1| hypothetical protein TcasGA2_TC004709 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307213743|gb|EFN89081.1| Agrin [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242020688|ref|XP_002430784.1| Agrin precursor, putative [Pediculus humanus corporis] gi|212515981|gb|EEB18046.1| Agrin precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340723263|ref|XP_003400011.1| PREDICTED: agrin-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350425393|ref|XP_003494108.1| PREDICTED: agrin-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307179324|gb|EFN67688.1| Agrin [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332020061|gb|EGI60512.1| Agrin [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322800543|gb|EFZ21535.1| hypothetical protein SINV_00404 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|328787536|ref|XP_391941.3| PREDICTED: agrin-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
ZFIN|ZDB-GENE-030131-1033 2028 agrn "agrin" [Danio rerio (tax 0.714 0.066 0.553 1e-37
UNIPROTKB|F1P3E3 1952 AGRN "Agrin" [Gallus gallus (t 0.899 0.087 0.478 1.8e-36
UNIPROTKB|F1NWQ6 1998 AGRN "Agrin" [Gallus gallus (t 0.899 0.085 0.478 1.9e-36
UNIPROTKB|P31696 2081 AGRN "Agrin" [Gallus gallus (t 0.899 0.081 0.478 2e-36
UNIPROTKB|F1MSI2 2032 AGRN "Uncharacterized protein" 0.825 0.076 0.470 1.4e-35
UNIPROTKB|I3LGD9 2039 I3LGD9 "Uncharacterized protei 0.825 0.076 0.470 5.9e-35
UNIPROTKB|F1Q2Z6 2046 AGRN "Uncharacterized protein" 0.666 0.061 0.542 9.7e-35
UNIPROTKB|O00468 2067 AGRN "Agrin" [Homo sapiens (ta 0.666 0.060 0.534 1.9e-34
MGI|MGI:87961 1950 Agrn "agrin" [Mus musculus (ta 0.825 0.08 0.476 1.9e-34
RGD|2067 1959 Agrn "agrin" [Rattus norvegicu 0.825 0.079 0.476 1.9e-34
ZFIN|ZDB-GENE-030131-1033 agrn "agrin" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 420 (152.9 bits), Expect = 1.0e-37, P = 1.0e-37
 Identities = 77/139 (55%), Positives = 86/139 (61%)

Query:     8 CLDSWYGCCPDNKTLAQGPDNAGCPSTCGCNKLGSTEDACIEDTEQCKCKQGVGGLKCDR 67
             C  + YGCC DNKT A G   AGCPS C CN  GS    C   T QC CK GVGGLKCDR
Sbjct:   764 CSQTVYGCCEDNKTAALGVGLAGCPSMCQCNHYGSYGGTCDPSTGQCSCKPGVGGLKCDR 823

Query:    68 CEPGYWGLSKISSYAPDIDGCLKCGCSQFGSVREDCEQMTGRCVCKPGVKGSKCNECLDP 127
             CEPG+W    I +   ++ GC  C C   GSVR+DCEQM+G C CKPGVKG KCN C D 
Sbjct:   824 CEPGFWNFRGIVT--ENMSGCTPCNCDGLGSVRDDCEQMSGLCSCKPGVKGMKCNVCPD- 880

Query:   128 NKKLGPNGCMPGMEV-KPC 145
               K+G NGC  G +  K C
Sbjct:   881 GSKMGVNGCDKGPKAPKSC 899
GO:0005605 "basal lamina" evidence=IEA
GO:0043113 "receptor clustering" evidence=IEA
GO:0007213 "G-protein coupled acetylcholine receptor signaling pathway" evidence=IEA
GO:0043236 "laminin binding" evidence=IEA
GO:0007409 "axonogenesis" evidence=IMP
GO:0007417 "central nervous system development" evidence=IMP
GO:0009952 "anterior/posterior pattern specification" evidence=IMP
GO:0007422 "peripheral nervous system development" evidence=IMP
GO:0016021 "integral to membrane" evidence=IEA
UNIPROTKB|F1P3E3 AGRN "Agrin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWQ6 AGRN "Agrin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P31696 AGRN "Agrin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MSI2 AGRN "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LGD9 I3LGD9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q2Z6 AGRN "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O00468 AGRN "Agrin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:87961 Agrn "agrin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2067 Agrn "agrin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O00468AGRIN_HUMANNo assigned EC number0.53480.66660.0609yesN/A
P31696AGRIN_CHICKNo assigned EC number0.55630.67720.0615yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 1e-07
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 3e-07
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 3e-07
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 5e-05
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 7e-05
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 1e-04
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information 
 Score = 45.8 bits (109), Expect = 1e-07
 Identities = 21/42 (50%), Positives = 24/42 (57%)

Query: 35 CGCNKLGSTEDACIEDTEQCKCKQGVGGLKCDRCEPGYWGLS 76
          C CN  GS    C   T QC+CK    G +CDRC PGY+GL 
Sbjct: 2  CDCNGHGSLSGQCDPGTGQCECKPNTTGRRCDRCAPGYYGLP 43

Length = 50
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 189
KOG0994|consensus 1758 99.94
KOG0994|consensus 1758 99.9
KOG3512|consensus592 99.83
KOG1836|consensus 1705 99.78
KOG1836|consensus 1705 99.76
KOG3512|consensus 592 99.39
KOG4289|consensus 2531 99.32
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 99.0
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 98.94
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 98.9
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 98.83
KOG4289|consensus 2531 98.82
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 98.79
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 98.74
KOG1225|consensus 525 97.92
KOG1388|consensus217 97.63
KOG3509|consensus964 97.43
KOG3509|consensus 964 96.98
KOG1225|consensus525 96.98
smart0005163 DSL delta serrate ligand. 96.91
smart0005163 DSL delta serrate ligand. 96.76
KOG4260|consensus350 96.3
KOG1226|consensus 783 95.84
KOG4260|consensus 350 95.77
KOG1388|consensus217 95.57
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 95.14
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 94.66
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 94.46
KOG1218|consensus316 93.39
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 89.33
KOG1226|consensus783 88.62
KOG1219|consensus 4289 88.45
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 87.86
KOG1218|consensus316 82.06
>KOG0994|consensus Back     alignment and domain information 
Probab=99.94  E-value=1.8e-27  Score=218.98  Aligned_cols=143  Identities=34%  Similarity=0.814  Sum_probs=134.3

Q ss_pred             CcCCCCCCCCCCCCCCCCCCeeecCCCccCCCCCcCCCCcccCCCCCCCCCCCCCCccCCCCCCCCCCCCCCCCCCcccc
Q psy11285         33 STCGCNKLGSTEDACIEDTEQCKCKQGVGGLKCDRCEPGYWGLSKISSYAPDIDGCLKCGCSQFGSVREDCEQMTGRCVC  112 (189)
Q Consensus        33 ~~C~C~~~g~~~~~C~~~tG~C~C~~~~~G~~C~~C~~G~~g~~~~~~~~~~~~~C~~C~C~~~gs~~~~C~~~tG~C~C  112 (189)
                      +.|+|++.|+++..|++..|+|.|+||+.|++|++|+||+||+        .+.+|++|+|+..||+...|+.+||||.|
T Consensus       763 ~~CnCnptGSlS~vCn~~GGqCqCkPnVVGR~CdqCApGtyGF--------GPsGCk~CdC~~~Gs~~~~Cd~~tGQC~C  834 (1758)
T KOG0994|consen  763 SMCNCNPTGSLSSVCNPNGGQCQCKPNVVGRRCDQCAPGTYGF--------GPSGCKACDCNSIGSLDKYCDKITGQCQC  834 (1758)
T ss_pred             cccccCCCccccccccCCCceecccCccccccccccCCcccCc--------CCccCccccccccccccccccccccceee
Confidence            4799999999999999999999999999999999999999999        46789999999999999999999999999


Q ss_pred             CCCcccCCCCcCCCCCCCCCCCCCCCCCCccCCCCCCCCccCCCccccCCC---CCCCCCCCCCCCcccCcCCCcCccCC
Q psy11285        113 KPGVKGSKCNECLDPNKKLGPNGCMPGMEVKPCNGEPPVINLQTGVELDCG---SGANREDCPSDAYCHITQNFARCCRK  189 (189)
Q Consensus       113 ~~g~~G~~C~~C~~g~~~~~~~~C~~~~~~~~C~~~~~~c~~~tg~c~~C~---~G~~C~~C~~g~~g~~~~~~~~~~~~  189 (189)
                      .+|+.|++|++|.||||+|+  .|+    .|+|+.|...|++.+|.|+.|.   +|.+|++|.+||||.+-......||+
T Consensus       835 ~~g~ygrqCnqCqpG~WgFP--eCr----~CqCNgHA~~Cd~~tGaCi~CqD~T~G~~CdrCl~GyyGdP~lg~g~~CrP  908 (1758)
T KOG0994|consen  835 RPGTYGRQCNQCQPGYWGFP--ECR----PCQCNGHADTCDPITGACIDCQDSTTGHSCDRCLDGYYGDPRLGSGIGCRP  908 (1758)
T ss_pred             ccccchhhccccCCCccCCC--cCc----cccccCcccccCccccccccccccccccchhhhhccccCCcccCCCCCCCC
Confidence            99999999999999999985  587    5789999999999999999885   79999999999999998888888875

>KOG0994|consensus Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1388|consensus Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG1388|consensus Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
4aqs_A525 Laminin Beta1 Ln-Le1-4 Structure Length = 525 3e-11
1klo_A162 Crystal Structure Of Three Consecutive Laminin-Type 3e-05
1npe_B164 Crystal Structure Of Nidogen/laminin Complex Length 3e-05
>pdb|4AQS|A Chain A, Laminin Beta1 Ln-Le1-4 Structure Length = 525 Back     alignment and structure 
Iteration: 1

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 55/99 (55%), Gaps = 9/99 (9%)
Query: 27  DNAGCPSTCGCNKLGSTE--DACIEDTEQCKCKQGVGGLKCDRCEPGYWGLSKISSYAPD 84
           D  GC S C CN LG+    + C  +T  C CK+ V G +CD+C P +WGLS       D
Sbjct: 434 DPYGCKS-CACNPLGTIPGGNPCDSETGYCYCKRLVTGQRCDQCLPQHWGLSN------D 486
Query: 85  IDGCLKCGCSQFGSVREDCEQMTGRCVCKPGVKGSKCNE 123
           +DGC  C C   G++   C + +G+C C P + G +CNE
Sbjct: 487 LDGCRPCDCDLGGALNNSCSEDSGQCSCLPHMIGRQCNE 525
>pdb|1KLO|A Chain A, Crystal Structure Of Three Consecutive Laminin-Type Epidermal Growth Factor-Like (Le) Modules Of Laminin Gamma1 Chain Harboring The Nidogen Binding Site Length = 162 Back     alignment and structure
>pdb|1NPE|B Chain B, Crystal Structure Of Nidogen/laminin Complex Length = 164 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 6e-18
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 3e-13
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 1e-04
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 5e-13
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 1e-05
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 3e-05
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 4e-09
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 3e-04
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 2e-07
2y38_A403 Laminin subunit alpha-5; structural protein, cell 4e-05
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 2e-04
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
 Score = 79.7 bits (196), Expect = 6e-18
 Identities = 41/112 (36%), Positives = 57/112 (50%), Gaps = 9/112 (8%)

Query: 14  GCCPDNKTLAQGPDNAGCPSTCGCNKLGSTE--DACIEDTEQCKCKQGVGGLKCDRCEPG 71
             C +        D  GC S C CN LG+    + C  +T  C CK+ V G +CD+C P 
Sbjct: 421 DVCKEGFYDLSAEDPYGCKS-CACNPLGTIPGGNPCDSETGYCYCKRLVTGQRCDQCLPQ 479

Query: 72  YWGLSKISSYAPDIDGCLKCGCSQFGSVREDCEQMTGRCVCKPGVKGSKCNE 123
           +WGLS       D+DGC  C C   G++   C + +G+C C P + G +CNE
Sbjct: 480 HWGLSN------DLDGCRPCDCDLGGALNNSCSEDSGQCSCLPHMIGRQCNE 525
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.91
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.86
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.61
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.58
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 99.52
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.51
2y38_A403 Laminin subunit alpha-5; structural protein, cell 99.49
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.23
2y38_A403 Laminin subunit alpha-5; structural protein, cell 99.22
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 99.12
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 99.08
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 98.63
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 98.27
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 98.24
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 98.2
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 98.07
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.06
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, 97.96
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 97.89
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 97.64
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 97.47
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 97.24
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 96.83
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 96.63
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 96.48
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 95.86
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 95.5
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 94.85
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 94.73
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 92.76
3fl7_A 536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 92.45
3urf_Z171 Tumor necrosis factor receptor superfamily member; 91.88
3qd6_R177 CD40L receptor, tumor necrosis factor receptor sup 91.21
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 90.28
3k51_B176 Decoy receptor 3; DCR3, TL1A, TNF, TNFR, immunity, 90.05
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 89.82
3me4_A216 Tumor necrosis factor receptor superfamily member; 89.25
3u3p_A 313 Tumor necrosis factor receptor superfamily member; 88.08
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 87.82
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 87.63
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 87.61
1sg1_X161 Tumor necrosis factor receptor superfamily member 87.27
1jma_B167 Herpesvirus entry mediator; V-type IG molecule and 86.78
3alq_R173 Tumor necrosis factor receptor superfamily member; 86.0
2uwi_A142 CRME protein; receptor, poxvirus TNF receptor, rec 84.38
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 84.19
1a3p_A45 Epidermal growth factor; disulfide connectivities, 83.1
2hey_R146 Tumor necrosis factor receptor superfamily member; 83.1
3fl7_A 536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 81.08
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
Probab=99.91  E-value=1.2e-25  Score=172.25  Aligned_cols=128  Identities=30%  Similarity=0.731  Sum_probs=103.9

Q ss_pred             CCCCCCCCCCCCccCCCCCCCCCCCCCCCCCCCcCCCCCCCCC--CCCCCCCCCee-ecCCCccCCCCCcCCCCcccCCC
Q psy11285          1 SGIYLKSCLDSWYGCCPDNKTLAQGPDNAGCPSTCGCNKLGST--EDACIEDTEQC-KCKQGVGGLKCDRCEPGYWGLSK   77 (189)
Q Consensus         1 ~G~~C~~C~~G~~g~~~~~~~~~~g~~~~~C~~~C~C~~~g~~--~~~C~~~tG~C-~C~~~~~G~~C~~C~~G~~g~~~   77 (189)
                      +|++||+|++||||+....     ......|+ +|+|++++..  ...|++.+|+| .|+++|+|++||+|++||||++.
T Consensus        28 ~G~~Ce~C~~g~~g~~~~~-----~~~~~~C~-~C~C~~~~~~~~~~~C~~~tG~C~~C~~g~~G~~Ce~C~~Gy~g~~~  101 (162)
T 1klo_A           28 AGKRCELCDDGYFGDPLGS-----NGPVRLCR-PCQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGFFGNPL  101 (162)
T ss_dssp             ESTTSCEECTTEEEETTCT-----TSSCEEEE-ECCSTTCBCTTCSCCBCTTTCCBCCBCTTEETTTTCEECTTEEECTT
T ss_pred             cCCCCcCCCCCCcCCcccc-----cCCCCCCe-eCcCCCCCCcccCCcccCCCCcccCCCCCCcCCCcCcCchhhcCCcc
Confidence            4889999999999973321     12235686 8999988643  24799999999 59999999999999999999875


Q ss_pred             CCCCCCCCCCCccCCCCCCCCCCC--CCCCCCCccccCCCcccCCCCcCCCCCCCCCC-CCCC
Q psy11285         78 ISSYAPDIDGCLKCGCSQFGSVRE--DCEQMTGRCVCKPGVKGSKCNECLDPNKKLGP-NGCM  137 (189)
Q Consensus        78 ~~~~~~~~~~C~~C~C~~~gs~~~--~C~~~tG~C~C~~g~~G~~C~~C~~g~~~~~~-~~C~  137 (189)
                      ...   ....|++|.|++.++++.  .|++++|+|.|+++|+|++|++|++|||++.. .+|+
T Consensus       102 ~~~---~~~~C~~C~C~~~Gs~~~~~~Cd~~tG~C~C~~g~~G~~Cd~C~~g~~g~~~~~GC~  161 (162)
T 1klo_A          102 APN---PADKCKACACNPYGTVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYNLQSGQGCE  161 (162)
T ss_dssp             CSS---GGGSEEECCCCTTTBGGGCCCCCTTTCCCCBCTTEESTTCCEECTTCBCGGGSSCCB
T ss_pred             ccC---CCCCCeeccCCCCCccCCCCCCCCCCCEeECCCCCcCCCCCCCCCCcccCCCCCCcC
Confidence            421   235699999999987753  89999999999999999999999999999863 4665
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3urf_Z Tumor necrosis factor receptor superfamily member; cystein-rich domain, beta-sandwich, cytokine; HET: NAG; 2.70A {Homo sapiens} PDB: 4e4d_R Back     alignment and structure
>3qd6_R CD40L receptor, tumor necrosis factor receptor superfamily member; immune regulator, cytokine-cytokine receptor compl; HET: NAG; 3.50A {Homo sapiens} Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Back     alignment and structure
>3k51_B Decoy receptor 3; DCR3, TL1A, TNF, TNFR, immunity, cytokine, D bond, glycoprotein, membrane, secreted, signal-anchor, transmembrane, apoptosis; 2.45A {Homo sapiens} PDB: 3mi8_D 3mhd_D Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>3me4_A Tumor necrosis factor receptor superfamily member; RANK, rankl, rankl-RANK complex, tnfsf11, tnfrsf11A, TNF SUP signaling protein; 2.01A {Mus musculus} PDB: 3me2_R 3qbq_B 4giq_R* 3nzy_B Back     alignment and structure
>3u3p_A Tumor necrosis factor receptor superfamily member; trigger apoptosis, apoptosis; 2.09A {Homo sapiens} PDB: 3u3q_A 3u3s_A 3u3t_A 3u3v_A 3qo4_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1sg1_X Tumor necrosis factor receptor superfamily member 16; nerve growth factor, NGF, neurotrophin, common neurotrophin receptor; 2.40A {Rattus norvegicus} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 g.24.1.1 PDB: 3buk_C* 3ij2_X Back     alignment and structure
>1jma_B Herpesvirus entry mediator; V-type IG molecule and TNFR superfamily, viral protein; HET: NAG; 2.65A {Human herpesvirus 1} SCOP: g.24.1.1 g.24.1.1 PDB: 2aw2_B* Back     alignment and structure
>3alq_R Tumor necrosis factor receptor superfamily member; ligand-receptor complex, cytokine, cytokine-cytokine recepto; 3.00A {Homo sapiens} Back     alignment and structure
>2uwi_A CRME protein; receptor, poxvirus TNF receptor, receptor immunomodulator, TNF alpha receptor; 2.0A {Vaccinia virus} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>2hey_R Tumor necrosis factor receptor superfamily member; cytokine, receptor-ligan complex, CO-stimulator, TNFSF; 2.00A {Homo sapiens} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 PDB: 2hev_R Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 189
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 2e-05
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: Laminin-type module
domain: Laminin gamma1 chain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 38.3 bits (89), Expect = 2e-05
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 2/44 (4%)

Query: 35 CGCNKLGSTEDACIED--TEQCKCKQGVGGLKCDRCEPGYWGLS 76
          C CN  G+ +     +  T QC+C   V G  C  C+PGY+ L 
Sbjct: 1  CACNPYGTVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYNLQ 44

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 99.1
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 99.06
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 99.01
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.68
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.49
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 97.33
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 91.08
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 90.85
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 90.39
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 89.4
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 89.35
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 89.19
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 87.9
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 87.7
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 87.25
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 87.04
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 86.89
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 86.28
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 85.75
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 85.45
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 84.99
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 84.82
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 84.79
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 83.51
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 82.68
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 82.43
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: Laminin-type module
domain: Laminin gamma1 chain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.10  E-value=1.7e-11  Score=75.65  Aligned_cols=52  Identities=33%  Similarity=0.732  Sum_probs=40.6

Q ss_pred             CCCCCCCC--CCCCCCCCCCee-ecCCCccCCCCCcCCCCcccCCCCCCCCCCCCCCccCC
Q psy11285         35 CGCNKLGS--TEDACIEDTEQC-KCKQGVGGLKCDRCEPGYWGLSKISSYAPDIDGCLKCG   92 (189)
Q Consensus        35 C~C~~~g~--~~~~C~~~tG~C-~C~~~~~G~~C~~C~~G~~g~~~~~~~~~~~~~C~~C~   92 (189)
                      |+|+.++.  ....|++.||+| .|+++++|++||+|++||||++.      ...+|++|+
T Consensus         1 C~Cn~~~~~~~~~~Cd~~tG~C~~C~~nt~G~~Cd~C~~G~yg~~~------~~~~C~~C~   55 (56)
T d1kloa2           1 CQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGFFGNPL------APNPADKCK   55 (56)
T ss_dssp             CCSTTCBCTTCSCCBCTTTCCBCCBCTTEETTTTCEECTTEEECTT------CSSGGGSEE
T ss_pred             CcCCCCCCCcccCccCCCCCCCCCCCCCCCCCCcCcccCCcccCCC------CCCCCCCCc
Confidence            45666553  345799999999 59999999999999999999764      345577663
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure