Diaphorina citri psyllid: psy11297


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MVPLVRMKRMGCLSASVVQSSQASPNLRLEESPCLSHPCQNGATCQDEEDGLFECLCSPEFTGYLCHTRAPPKLYDTPAFNGSSHIVMKTLKAYNKLSIEIEFKTNKNDGILLYNQQNLDGTGDFVSLAIVN
cccccccccccccccccccccccccccccccccccccccccccEEECccccCEEEEccccccccccccccccccccccccccccEEEEcccccccccEEEEEEEcccccccEEEccccccccccEEEEEEEc
MVPLVRMKRMGCLSASVVQSSQASPNLRLEESPCLSHPCQNGATCQDEEDGLFECLCSPEFTGYLCHTRAPPKLYDTPAFNGSSHIVMKTLKAYNKLSIEIEFKTNKNDGILLYNQQNLDGTGDFVSLAIVN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVPLVRMKRMGCLSASVVQSSQASPNLRLEESPCLSHPCQNGATCQDEEDGLFECLCSPEFTGYLCHTRAPPKLYDTPAFNGSSHIVMKTLKAYNKLSIEIEFKTNKNDGILLYNQQNLDGTGDFVSLAIVN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0019219 [BP]regulation of nucleobase-containing compound metabolic processprobableGO:0080090, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0050790 [BP]regulation of catalytic activityprobableGO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0044700 [BP]single organism signalingprobableGO:0008150, GO:0023052, GO:0044699
GO:0010604 [BP]positive regulation of macromolecule metabolic processprobableGO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0009966 [BP]regulation of signal transductionprobableGO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0005539 [MF]glycosaminoglycan bindingprobableGO:0097367, GO:0003674, GO:0005488
GO:0031410 [CC]cytoplasmic vesicleprobableGO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0032991 [CC]macromolecular complexprobableGO:0005575
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0031325 [BP]positive regulation of cellular metabolic processprobableGO:0009893, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0048699 [BP]generation of neuronsprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0005604 [CC]basement membraneprobableGO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421
GO:0007417 [BP]central nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0007154 [BP]cell communicationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0001932 [BP]regulation of protein phosphorylationprobableGO:0042325, GO:0032268, GO:0019220, GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0051246, GO:0050794, GO:0051174, GO:0065007, GO:0031399, GO:0008150, GO:0050789

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QCW, chain A
Confidence level:very confident
Coverage over the Query: 26-132
View the alignment between query and template
View the model in PyMOL
Template: 2VJ3, chain A
Confidence level:very confident
Coverage over the Query: 7-88
View the alignment between query and template
View the model in PyMOL