Psyllid ID: psy11297
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 132 | ||||||
| 189233617 | 2027 | PREDICTED: similar to agrin [Tribolium c | 0.727 | 0.047 | 0.550 | 1e-27 | |
| 270014663 | 1796 | hypothetical protein TcasGA2_TC004709 [T | 0.886 | 0.065 | 0.550 | 2e-27 | |
| 322800551 | 948 | hypothetical protein SINV_11086 [Solenop | 0.75 | 0.104 | 0.533 | 7e-25 | |
| 340723263 | 2243 | PREDICTED: agrin-like [Bombus terrestris | 0.719 | 0.042 | 0.525 | 7e-24 | |
| 350425393 | 2243 | PREDICTED: agrin-like [Bombus impatiens] | 0.719 | 0.042 | 0.525 | 8e-24 | |
| 332020061 | 713 | Agrin [Acromyrmex echinatior] | 0.886 | 0.164 | 0.475 | 1e-23 | |
| 383850257 | 1852 | PREDICTED: agrin-like [Megachile rotunda | 0.734 | 0.052 | 0.525 | 1e-23 | |
| 307179324 | 1668 | Agrin [Camponotus floridanus] | 0.75 | 0.059 | 0.524 | 2e-23 | |
| 357602540 | 2033 | hypothetical protein KGM_16605 [Danaus p | 0.780 | 0.050 | 0.542 | 2e-22 | |
| 380027342 | 1784 | PREDICTED: agrin-like [Apis florea] | 0.742 | 0.054 | 0.505 | 1e-21 |
| >gi|189233617|ref|XP_001811978.1| PREDICTED: similar to agrin [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 127 bits (320), Expect = 1e-27, Method: Compositional matrix adjust.
Identities = 65/118 (55%), Positives = 79/118 (66%)
Query: 15 ASVVQSSQASPNLRLEESPCLSHPCQNGATCQDEEDGLFECLCSPEFTGYLCHTRAPPKL 74
+S Q A PN E C S PC +G+TC D F C+C FTG LC T K
Sbjct: 1247 SSDRQECIADPNPTDEYRACSSSPCHHGSTCVDLPAATFTCVCETNFTGSLCETEVIHKQ 1306
Query: 75 YDTPAFNGSSHIVMKTLKAYNKLSIEIEFKTNKNDGILLYNQQNLDGTGDFVSLAIVN 132
Y+TPAF+G S++ +K LKAY+KLSIE+EFKT+ +DG+LLYNQQ DG GDFVSLAIVN
Sbjct: 1307 YNTPAFHGRSYVKLKPLKAYHKLSIEVEFKTHSHDGLLLYNQQKPDGLGDFVSLAIVN 1364
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270014663|gb|EFA11111.1| hypothetical protein TcasGA2_TC004709 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|322800551|gb|EFZ21543.1| hypothetical protein SINV_11086 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|340723263|ref|XP_003400011.1| PREDICTED: agrin-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350425393|ref|XP_003494108.1| PREDICTED: agrin-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|332020061|gb|EGI60512.1| Agrin [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|383850257|ref|XP_003700712.1| PREDICTED: agrin-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307179324|gb|EFN67688.1| Agrin [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|357602540|gb|EHJ63446.1| hypothetical protein KGM_16605 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|380027342|ref|XP_003697386.1| PREDICTED: agrin-like [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 132 | ||||||
| UNIPROTKB|F1P3E3 | 1952 | AGRN "Agrin" [Gallus gallus (t | 0.696 | 0.047 | 0.44 | 8.1e-14 | |
| UNIPROTKB|F1NWQ6 | 1998 | AGRN "Agrin" [Gallus gallus (t | 0.696 | 0.046 | 0.44 | 8.3e-14 | |
| UNIPROTKB|P31696 | 2081 | AGRN "Agrin" [Gallus gallus (t | 0.696 | 0.044 | 0.44 | 8.7e-14 | |
| UNIPROTKB|F1LQ53 | 963 | Agrn "Agrin" [Rattus norvegicu | 0.712 | 0.097 | 0.4 | 1.1e-13 | |
| RGD|2067 | 1959 | Agrn "agrin" [Rattus norvegicu | 0.780 | 0.052 | 0.376 | 2.2e-13 | |
| UNIPROTKB|I3LGD9 | 2039 | I3LGD9 "Uncharacterized protei | 0.772 | 0.050 | 0.388 | 7.7e-13 | |
| UNIPROTKB|F1Q2Z6 | 2046 | AGRN "Uncharacterized protein" | 0.765 | 0.049 | 0.394 | 1.6e-12 | |
| ZFIN|ZDB-GENE-030131-1033 | 2028 | agrn "agrin" [Danio rerio (tax | 0.712 | 0.046 | 0.38 | 2e-12 | |
| UNIPROTKB|F1MSI2 | 2032 | AGRN "Uncharacterized protein" | 0.772 | 0.050 | 0.370 | 5.4e-12 | |
| MGI|MGI:87961 | 1950 | Agrn "agrin" [Mus musculus (ta | 0.712 | 0.048 | 0.39 | 6.6e-12 |
| UNIPROTKB|F1P3E3 AGRN "Agrin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 195 (73.7 bits), Expect = 8.1e-14, P = 8.1e-14
Identities = 44/100 (44%), Positives = 59/100 (59%)
Query: 33 PCLSHPCQNGATCQDEEDGL-FECLCSPEFTGYLCHTRAPPKLYDTPAFNGSSHIVMKTL 91
PC SHPC +G TC+D DG F C C G +C P Y P+F G S++ K +
Sbjct: 1228 PCDSHPCLHGGTCED--DGKEFTCSCPAGKGGAVCEK---PIRYFIPSFGGKSYLAFKMM 1282
Query: 92 KAYNKLSIEIEFKTNKNDGILLYNQQNLDGTGDFVSLAIV 131
KAY+ + I +EF+ + G+LLYN QN G DF+SLA+V
Sbjct: 1283 KAYHTVRIAMEFRATELSGLLLYNGQNR-GK-DFISLALV 1320
|
|
| UNIPROTKB|F1NWQ6 AGRN "Agrin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P31696 AGRN "Agrin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LQ53 Agrn "Agrin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|2067 Agrn "agrin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LGD9 I3LGD9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q2Z6 AGRN "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-1033 agrn "agrin" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MSI2 AGRN "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:87961 Agrn "agrin" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 132 | |||
| cd00110 | 151 | cd00110, LamG, Laminin G domain; Laminin G-like do | 3e-08 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 6e-06 | |
| smart00282 | 132 | smart00282, LamG, Laminin G domain | 2e-04 | |
| cd00053 | 36 | cd00053, EGF, Epidermal growth factor domain, foun | 2e-04 | |
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 2e-04 | |
| pfam00008 | 32 | pfam00008, EGF, EGF-like domain | 0.003 |
| >gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
Score = 48.6 bits (116), Expect = 3e-08
Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 3/54 (5%)
Query: 80 FNGSSHIVMKTLKA-YNKLSIEIEFKTNKNDGILLYNQQNLDGTGDFVSLAIVN 132
F+GSS++ + TL A +LSI F+T +G+LLY GDF++L + +
Sbjct: 4 FSGSSYVRLPTLPAPRTRLSISFSFRTTSPNGLLLYAGS--QNGGDFLALELED 55
|
Proteins that contain LamG domains serve a variety of purposes including signal transduction via cell-surface steroid receptors, adhesion, migration and differentiation through mediation of cell adhesion molecules. Length = 151 |
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214598 smart00282, LamG, Laminin G domain | Back alignment and domain information |
|---|
| >gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|215652 pfam00008, EGF, EGF-like domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 132 | |||
| KOG4289|consensus | 2531 | 99.8 | ||
| KOG3514|consensus | 1591 | 99.27 | ||
| KOG1219|consensus | 4289 | 99.25 | ||
| KOG4289|consensus | 2531 | 99.1 | ||
| KOG1219|consensus | 4289 | 99.05 | ||
| KOG3516|consensus | 1306 | 99.04 | ||
| KOG3516|consensus | 1306 | 99.02 | ||
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 98.85 | |
| KOG3514|consensus | 1591 | 98.74 | ||
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 98.5 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 98.29 | |
| cd00110 | 151 | LamG Laminin G domain; Laminin G-like domains are | 98.08 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 97.99 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 97.97 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 97.93 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 97.1 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 97.07 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 95.77 | |
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 95.13 | |
| KOG1214|consensus | 1289 | 95.06 | ||
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 95.0 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 94.82 | |
| KOG1225|consensus | 525 | 94.33 | ||
| KOG1217|consensus | 487 | 94.04 | ||
| PF12946 | 37 | EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 | 93.96 | |
| KOG1217|consensus | 487 | 93.96 | ||
| KOG4260|consensus | 350 | 93.08 | ||
| smart00051 | 63 | DSL delta serrate ligand. | 92.6 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 91.82 | |
| KOG1225|consensus | 525 | 90.99 | ||
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 90.67 | |
| KOG1214|consensus | 1289 | 87.47 | ||
| PF00053 | 49 | Laminin_EGF: Laminin EGF-like (Domains III and V); | 86.51 | |
| cd00055 | 50 | EGF_Lam Laminin-type epidermal growth factor-like | 84.85 | |
| PF12955 | 103 | DUF3844: Domain of unknown function (DUF3844); Int | 82.98 | |
| KOG1226|consensus | 783 | 81.9 | ||
| KOG1836|consensus | 1705 | 81.47 |
| >KOG4289|consensus | Back alignment and domain information |
|---|
Probab=99.80 E-value=2.1e-19 Score=150.20 Aligned_cols=117 Identities=28% Similarity=0.539 Sum_probs=98.0
Q ss_pred CccCCeecCCCCCCCCcccCCCCCCCCCCCCCCeEeeCCCCceEEeCCCCccCCcccccCCC------------------
Q psy11297 11 GCLSASVVQSSQASPNLRLEESPCLSHPCQNGATCQDEEDGLFECLCSPEFTGYLCHTRAPP------------------ 72 (132)
Q Consensus 11 ~~~~~~~cp~~~~g~~C~~~~~~C~~~pC~ngg~C~~~~~~~~~C~C~~g~~G~~C~~~~~~------------------ 72 (132)
+.++.. ||..|+|..|+.++|.|-+.||.|+|+|....+ +|+|.|.+||+|++||.+...
T Consensus 1220 nglrCr-CPpGFTgd~CeTeiDlCYs~pC~nng~C~srEg-gYtCeCrpg~tGehCEvs~~agrCvpGvC~nggtC~~~~ 1297 (2531)
T KOG4289|consen 1220 NGLRCR-CPPGFTGDYCETEIDLCYSGPCGNNGRCRSREG-GYTCECRPGFTGEHCEVSARAGRCVPGVCKNGGTCVNLL 1297 (2531)
T ss_pred CceeEe-CCCCCCcccccchhHhhhcCCCCCCCceEEecC-ceeEEecCCccccceeeecccCccccceecCCCEEeecC
Confidence 334433 455566999999999999999999999999985 599999999999999986532
Q ss_pred -----------------CCCCCCCCCCcceEEecccCCceeEEEEEEEEeCCCCeEEEEeccCCCCCCCeEEEEEcC
Q psy11297 73 -----------------KLYDTPAFNGSSHIVMKTLKAYNKLSIEIEFKTNKNDGILLYNQQNLDGTGDFVSLAIVN 132 (132)
Q Consensus 73 -----------------c~~~~~~~~g~~~~~~~~~~~~~~~~i~~~f~t~~~~g~ll~~~~~~~~~~d~~~l~l~~ 132 (132)
|+....+|.+.+|+.|.+++.+.++.++|.|.|...+|+|+|+|.+ ++||++|++++
T Consensus 1298 nggf~c~Cp~ge~e~prC~v~trSFp~~sfv~frglrqRfh~TlslsfaT~~~nGlL~ynGne---khDFvalevVd 1371 (2531)
T KOG4289|consen 1298 NGGFCCHCPYGEFEDPRCEVTTRSFPPESFVTFRGLRQRFHFTLSLSFATIERNGLLLYNGNE---KHDFVALEVVD 1371 (2531)
T ss_pred CCceeccCCCcccCCCceEEEeeccCchheEEEeccccceEEEEEEEEEEeeecceEEecCCc---ccceEeeeeee
Confidence 1123345777889999999999999999999999999999999954 89999999975
|
|
| >KOG3514|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG3516|consensus | Back alignment and domain information |
|---|
| >KOG3516|consensus | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG3514|consensus | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation | Back alignment and domain information |
|---|
| >cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >PF12955 DUF3844: Domain of unknown function (DUF3844); InterPro: IPR024382 This presumed domain is found in fungal species | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 132 | ||||
| 3pve_A | 189 | Crystal Structure Of The G2 Domain Of Agrin From Mu | 1e-06 |
| >pdb|3PVE|A Chain A, Crystal Structure Of The G2 Domain Of Agrin From Mus Musculus Length = 189 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 132 | |||
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 1e-17 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 1e-10 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 2e-16 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 2e-15 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 4e-12 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 5e-11 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 4e-09 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 1e-08 | |
| 3pve_A | 189 | Agrin, AGRN protein; mRNA splicing, structural gen | 5e-13 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 6e-12 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 7e-12 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 2e-09 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 3e-11 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 6e-05 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 6e-11 | |
| 1pz7_A | 204 | Agrin; structural protein; 1.42A {Gallus gallus} S | 6e-11 | |
| 3v64_A | 191 | Low-density lipoprotein receptor-related protein; | 1e-10 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 4e-10 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 1e-09 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 2e-08 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 5e-10 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 2e-06 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 6e-10 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 8e-10 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 3e-09 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 9e-08 | |
| 2r16_A | 182 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sp | 9e-10 | |
| 2h0b_A | 184 | Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A | 9e-10 | |
| 1d2s_A | 170 | SHBG, sex hormone-binding globulin; steroid transp | 2e-09 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 7e-09 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 4e-06 | |
| 1f5f_A | 205 | SHBG, sex hormone-binding globulin; jellyroll, sig | 1e-08 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 1e-08 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 1e-04 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 2e-08 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 3e-07 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 2e-04 | |
| 3sh4_A | 195 | LG3 peptide; actin disassambly, integrin alpha12 B | 2e-08 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 9e-08 | |
| 3bod_A | 178 | Neurexin-1-alpha; neurexin1D, LNS6, alternative sp | 1e-07 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 1e-07 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 2e-06 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 2e-04 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 2e-07 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 4e-07 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 2e-06 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 1e-04 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 5e-04 | |
| 2r1d_A | 226 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 3e-06 | |
| 2r1b_A | 220 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 3e-06 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 5e-06 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 2e-05 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 1e-04 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 2e-04 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 6e-04 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 2e-04 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 9e-04 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 3e-04 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 5e-04 |
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 | Back alignment and structure |
|---|
Score = 76.6 bits (188), Expect = 1e-17
Identities = 25/121 (20%), Positives = 45/121 (37%), Gaps = 3/121 (2%)
Query: 13 LSASVVQSSQASPNLRLEESPCLSHPCQNGATCQDEEDGLFECLCSPE-FTGYLCHTRAP 71
+S ++ + Q + C C N C + DG F C CS F+G LC+
Sbjct: 167 ISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDG-FSCDCSMTSFSGPLCNDPGT 225
Query: 72 PKLYDTPAFNGSSHIVMKTLKAYNKLSIEIEFKTNKNDGILLYNQQNLDGTGDFVSLAIV 131
++ + + + I F T + + +L+ + G GD++ L I
Sbjct: 226 TYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSS-SGLGDYLELHIH 284
Query: 132 N 132
Sbjct: 285 Q 285
|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 | Back alignment and structure |
|---|
| >1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 | Back alignment and structure |
|---|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 | Back alignment and structure |
|---|
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 | Back alignment and structure |
|---|
| >1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 | Back alignment and structure |
|---|
| >1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Length = 205 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 | Back alignment and structure |
|---|
| >3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Length = 178 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Length = 226 | Back alignment and structure |
|---|
| >2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Length = 220 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Length = 553 | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* 3krk_A* ... Length = 587 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 132 | |||
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 99.57 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 99.49 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 99.45 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 99.43 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 99.19 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.14 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 99.11 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.08 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 99.02 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 99.02 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.01 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 99.0 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 98.89 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 98.88 | |
| 1pz7_A | 204 | Agrin; structural protein; 1.42A {Gallus gallus} S | 98.85 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 98.84 | |
| 3pve_A | 189 | Agrin, AGRN protein; mRNA splicing, structural gen | 98.71 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 98.69 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 98.65 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 98.63 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 98.57 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 98.55 | |
| 3v64_A | 191 | Low-density lipoprotein receptor-related protein; | 98.53 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 98.51 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 98.49 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 98.48 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 98.46 | |
| 2h0b_A | 184 | Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A | 98.43 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 98.43 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 98.42 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 98.42 | |
| 2r16_A | 182 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sp | 98.41 | |
| 3sh4_A | 195 | LG3 peptide; actin disassambly, integrin alpha12 B | 98.4 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 98.38 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 98.37 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 98.36 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 98.35 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 98.35 | |
| 1d2s_A | 170 | SHBG, sex hormone-binding globulin; steroid transp | 98.32 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 98.3 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 98.29 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 98.29 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 98.24 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 98.22 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 98.2 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 98.19 | |
| 2r1b_A | 220 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 98.18 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.16 | |
| 1f5f_A | 205 | SHBG, sex hormone-binding globulin; jellyroll, sig | 98.15 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 98.15 | |
| 2r1d_A | 226 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 98.14 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 98.12 | |
| 3bod_A | 178 | Neurexin-1-alpha; neurexin1D, LNS6, alternative sp | 98.11 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 98.1 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 98.07 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 98.07 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 98.04 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 98.03 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 98.0 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 97.95 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 97.94 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 97.92 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 97.91 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 97.88 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 97.87 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 97.86 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 97.85 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 97.83 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 97.81 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 97.8 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 97.78 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 97.77 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 97.75 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 97.67 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 97.67 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 97.67 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 97.65 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 97.62 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 97.6 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 97.6 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 97.56 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 97.54 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 97.53 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 97.5 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 97.49 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 97.48 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.46 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 97.41 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 97.4 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 97.38 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 97.33 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 97.3 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 97.3 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 97.28 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 97.23 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 97.22 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 97.13 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 97.11 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 97.03 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 97.02 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 96.98 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 96.9 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 96.86 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 96.65 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 96.56 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 96.5 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 96.39 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 96.24 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 95.75 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 95.46 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 95.33 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 95.27 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 94.9 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 94.54 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 94.16 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 93.84 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 92.88 | |
| 3t5o_A | 913 | Complement component C6; macpf, MAC, membrane atta | 92.75 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 92.46 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 92.05 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 90.97 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 90.68 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 88.46 | |
| 3fby_A | 551 | COMP, cartilage oligomeric matrix protein; signatu | 87.93 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 86.15 | |
| 1lr7_A | 74 | Follistatin, FS1; heparin-binding, cystine-rich, s | 84.28 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 83.09 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 81.92 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 80.95 |
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
Probab=99.57 E-value=1.2e-14 Score=111.28 Aligned_cols=100 Identities=26% Similarity=0.476 Sum_probs=77.3
Q ss_pred CcccCCCCCCCCCCCCCCeEeeCCCCceEEeCCC-CccCCcccccCCCCCCCCCCC-CCcceEEecccC----CceeEEE
Q psy11297 26 NLRLEESPCLSHPCQNGATCQDEEDGLFECLCSP-EFTGYLCHTRAPPKLYDTPAF-NGSSHIVMKTLK----AYNKLSI 99 (132)
Q Consensus 26 ~C~~~~~~C~~~pC~ngg~C~~~~~~~~~C~C~~-g~~G~~C~~~~~~c~~~~~~~-~g~~~~~~~~~~----~~~~~~i 99 (132)
.|+...+.|.++||.|+|+|++.++ +|+|.|+. +|.|+.|+.... ...| .+++|+.+.... ......+
T Consensus 180 gC~~~~~~C~~~pC~n~g~C~~~~~-~~~C~C~~~~~~G~~C~~~~~-----~~~f~~~~~~~~~~~~~~~~~~~~~~~i 253 (410)
T 3asi_A 180 GCEGPSTTCQEDSCSNQGVCLQQWD-GFSCDCSMTSFSGPLCNDPGT-----TYIFSKGGGQITYKWPPNDRPSTRADRL 253 (410)
T ss_dssp SCCCCSSCCCTTSSSTTCEEEECSS-SEEEECTTTSEESTTSCEECC-----EEEEEEEEEEEEEECCTTCCCCBSEEEE
T ss_pred CCCCCCCCcccccCCCCCEecCCCC-CceEeccCCcccCCCCCCCcc-----cccccCCCceEEEecCCCCCccceeeEE
Confidence 5655567899999999999999986 59999985 999999998652 2234 466788764221 2234589
Q ss_pred EEEEEeCCCCeEEEEeccCCCCCCCeEEEEEcC
Q psy11297 100 EIEFKTNKNDGILLYNQQNLDGTGDFVSLAIVN 132 (132)
Q Consensus 100 ~~~f~t~~~~g~ll~~~~~~~~~~d~~~l~l~~ 132 (132)
+|.|||..++|+|||.+.... ..||++|+|++
T Consensus 254 ~l~frT~~~~GlLl~~~~~~~-~~~~l~l~L~~ 285 (410)
T 3asi_A 254 AIGFSTVQKEAVLVRVDSSSG-LGDYLELHIHQ 285 (410)
T ss_dssp EEEEECCCSEEEEEEEEECTT-CCCEEEEEEET
T ss_pred EEEEEeCCCCEEEEEEecCCC-CCceEEEEEeC
Confidence 999999999999999876422 47999999975
|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} | Back alignment and structure |
|---|
| >3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 132 | ||||
| d1h30a1 | 191 | b.29.1.4 (A:261-451) Growth-arrest-specific protei | 1e-10 | |
| d2vj3a2 | 39 | g.3.11.1 (A:453-491) Neurogenic locus notch homolo | 3e-10 | |
| d1edmb_ | 39 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 7e-10 | |
| d1xkba1 | 39 | g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu | 8e-10 | |
| d2vj3a3 | 35 | g.3.11.1 (A:492-526) Neurogenic locus notch homolo | 1e-09 | |
| d1dyka1 | 189 | b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse | 2e-09 | |
| d2c4fl1 | 37 | g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof | 2e-09 | |
| d1g1ta2 | 39 | g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human | 2e-09 | |
| d1cvua2 | 41 | g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG | 4e-09 | |
| d1g1sa2 | 40 | g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human | 1e-08 | |
| d1q4ga2 | 42 | g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG | 1e-08 | |
| d3egfa_ | 53 | g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse | 1e-08 | |
| d1pz7a_ | 195 | b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxI | 4e-08 | |
| d1nqlb_ | 48 | g.3.11.1 (B:) Epidermal growth factor, EGF {Human | 4e-08 | |
| d2vj3a1 | 42 | g.3.11.1 (A:411-452) Neurogenic locus notch homolo | 9e-08 | |
| d1dyka2 | 185 | b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse | 2e-07 | |
| d1tpga1 | 41 | g.3.11.1 (A:51-91) Plasminogen activator (tissue-t | 3e-07 | |
| d1haea_ | 63 | g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu | 3e-07 | |
| d1autl1 | 48 | g.3.11.1 (L:49-96) Activated protein c (autoprothr | 5e-07 | |
| d1d2sa_ | 170 | b.29.1.4 (A:) Sex hormone-binding globulin {Human | 3e-06 | |
| d2r1da1 | 177 | b.29.1.4 (A:36-212) Ligand-binding domain of neure | 1e-05 | |
| d1ioxa_ | 50 | g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) | 2e-04 | |
| d1k36a_ | 46 | g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo | 0.002 | |
| d1moxc_ | 49 | g.3.11.1 (C:) Transforming growth factor alpha {Hu | 0.003 |
| >d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Laminin G-like module domain: Growth-arrest-specific protein Gas6 species: Human (Homo sapiens) [TaxId: 9606]
Score = 54.1 bits (129), Expect = 1e-10
Identities = 21/97 (21%), Positives = 38/97 (39%), Gaps = 14/97 (14%)
Query: 37 HPCQNGATCQDEEDGLFECLCSPEFTGYLCHTRAPPKLYDTPAFNGSSHIVMK-TLKAYN 95
Q+ TC+D C P ++ LY F+G+ I ++
Sbjct: 9 KLSQDMDTCEDI------LPCVPFSVA-----KSVKSLYLGRMFSGTPVIRLRFKRLQPT 57
Query: 96 KLSIEIEFKTNKNDGILLYNQQNLDGTGDFVSLAIVN 132
+L E +F+T +GILL+ + ++ LA+
Sbjct: 58 RLVAEFDFRTFDPEGILLFAGGH--QDSTWIVLALRA 92
|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 195 | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 185 | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 177 | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 50 | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 49 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 132 | |||
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 99.45 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 99.42 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 99.4 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 99.38 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 99.37 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 99.34 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 99.34 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 99.29 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 99.29 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 99.24 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 99.21 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 99.19 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 98.96 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 98.87 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 98.82 | |
| d1h30a1 | 191 | Growth-arrest-specific protein Gas6 {Human (Homo s | 98.47 | |
| d1dyka2 | 185 | Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: | 98.38 | |
| d1pz7a_ | 195 | Agrin {Chicken (Gallus gallus) [TaxId: 9031]} | 98.34 | |
| d1dyka1 | 189 | Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: | 98.27 | |
| d1d2sa_ | 170 | Sex hormone-binding globulin {Human (Homo sapiens) | 98.21 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 98.14 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 98.12 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.12 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 98.05 | |
| d2r1da1 | 177 | Ligand-binding domain of neurexin 1beta {Rat (Ratt | 97.98 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 97.91 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.87 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.83 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.76 | |
| d1h30a2 | 218 | Growth-arrest-specific protein Gas6 {Human (Homo s | 97.64 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.61 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 97.23 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 97.15 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 97.1 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 97.05 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 97.02 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.96 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 96.9 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 96.29 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 96.16 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 95.8 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 94.91 | |
| d1dx5i1 | 43 | Thrombomodulin, different EGF-like domains {Human | 93.63 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 90.05 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 88.94 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 88.07 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 87.53 | |
| d2bz6l1 | 53 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 86.95 | |
| d1jv2b5 | 43 | Integrin beta EGF-like domains {Human (Homo sapien | 86.89 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 85.26 |
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Neurogenic locus notch homolog protein 1, Notch1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.45 E-value=4.1e-14 Score=72.60 Aligned_cols=38 Identities=42% Similarity=1.029 Sum_probs=35.0
Q ss_pred CCCCCCCCCCCCCeEeeCCCCceEEeCCCCccCCccccc
Q psy11297 31 ESPCLSHPCQNGATCQDEEDGLFECLCSPEFTGYLCHTR 69 (132)
Q Consensus 31 ~~~C~~~pC~ngg~C~~~~~~~~~C~C~~g~~G~~C~~~ 69 (132)
+|+|.++||+|+|+|++..+ +|+|.|++||+|++||.+
T Consensus 1 Id~C~~~PC~n~g~C~~~~~-~y~C~C~~G~~G~~Ce~d 38 (39)
T d2vj3a2 1 VNECVSNPCQNDATCLDQIG-EFQCICMPGYEGVHCEVN 38 (39)
T ss_dssp CCTTTTCCCCSSCEEEECSS-CEEEECCTTEESSSSCEE
T ss_pred CcCCcCCCCCCCCEEECCCC-CEEEeCCCCCccCcCeeC
Confidence 58999999999999999885 599999999999999874
|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|