Diaphorina citri psyllid: psy11302

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760----

MYVKIRSLDGSKNCVLVLSKRTLISDMKTQIENTLDVPVDKQRLFYKGKQLEDEYMLFDYNVNLNDVIQLMIKADIDKNYQSSESSSKENIQPNGPACKPNINTENASSSGNNTEPEDFVDLKPADSQYYKVGDYVDAILETEGAWFESQITHILVDINKEKPYDEDDLIFKVVHLKYKDDGSSTMKFDDIRPLPKHLITEFNENLIGVRVMGNYNAEEPRERGYWHDMIIEKKQGKRLTTELIATVFIGKKGLETRLENCKIKFVKELYKIESPKLLAERTAEDEDHMSTEPKTLRQIVPECTTCNDVETKHCKDCGCSICAGKTSPDKLIVCEECQHYYHIWCLKPPLESVPEDDEWFCPSCKRDTSEVIAPGQKLKDSKKKARMASTNSKSTRDWGKGMACVGRTKVCTIVPSDHFGPIPGIEVGQSYLYRFQASEAGVHRPHVSGIHGREDVGAFSLVLSGGYEDDVDDGDSFLYTGSGGRDLSGNKRTSVQSFDQTLTRMNKALARNCNAPIDDKRGNEAVDWKKGKPVRVMRNFHGAKHSKYAPKEGNRYDGIYKVVKYYPVKGSSDFIVWRFHLQRDDEAPAPWTEEGKKRIKDLGLQMIYPEGYEEAQAAKEASKANLKRKVSSETLGESKVKKSKQVYTLPSSVLEHINNDTVHSNVWDEIKALCKEGQKEVLEHIQEKFLCIICQELVYKPITLDCVHTFCHDCLKRAFKIESDACNSCPYCRKEMNKSCLETHSNDALQSILSTLFPGYSSAR

cEEEEEEcccccEEEEEEcccccHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEcccccccccccccEEEEEEccccccccccccccccccccccccccccccccccEEEEcccccccccccccccEEEEEccccccccEEEEEEEEccccccccccccccHHcHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccEEccccccccccccccccccccccHHHcccccccccccccccccccccEEEEEcccccccccccccEEEEcccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccEEEEEcccccccccccccccEEEccEEEEEEEEEECcccccEEEEEEEEEccccccccccccccHHHcccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHcccccccccccHHHHHHHHHHHHHHcccccccccccccHHHHHcccccccHHHHHHHHHHcccccccc

*YVKIRSLDGSKNCVLVLSKRTLISDMKTQIENTLDVPVDKQRLFYKGKQLEDEYMLFDYNVNLNDVIQLMIKAD**************************************************DSQYYKVGDYVDAILETEGAWFESQITHILVDINKEKPYDEDDLIFKVVHLKYKDDGSSTMKFDDIRPLPKHLITEFNENLIGVRVMGNYNAEEPRERGYWHDMIIEKKQGKRLTTELIATVFIGKKGLETRLENCKIKFVKELYKIES************************IVPECTTCNDVETKHCKDCGCSICAGKTSPDKLIVCEECQHYYHIWCLKPPLESVPEDDEWFCPSCKRDTSEVIAPGQKLKDSKKKARMAS****STRDWGKGMACVGRTKVCTIVPSDHFGPIPGIEVGQSYLYRFQASEAGVHRPHVSGIHGREDVGAFSLVLSGGYEDDVDDGDSFLYTGS************************KA*A****A******GNEAVDWKKGKPVRVMRNFHGAK**KYAPKEGNRYDGIYKVVKYYPVKGSSDFIVWRFHLQRDDEAPAPWTEEGKKRIKDLGLQMIY*************************************VYTLPSSVLEHINNDTVHSNVWDEIKALCKEGQKEVLEHIQEKFLCIICQELVYKPITLDCVHTFCHDCLKRAFKIESDACNSCPYCRKEMNKSCLETHSNDALQSILSTLFPGYS***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
E3 ubiquitin-protein ligase UHRF1	Multidomain protein that acts as a key epigenetic regulator by bridging DNA methylation and chromatin modification. Specifically recognizes and binds hemimethylated DNA at replication forks via its YDG domain and recruits dnmt1 methyltransferase to ensure faithful propagation of the DNA methylation patterns through DNA replication. In addition to its role in maintenance of DNA methylation, also plays a key role in chromatin modification: through its tudor-like regions and PHD-type zinc fingers, specifically recognizes and binds histone H3 trimethylated at 'Lys-9' (H3K9me3) and unmethylated at 'Arg-2' (H3R2me0), respectively, and recruits chromatin proteins. Enriched in pericentric heterochromatin where it recruits different chromatin modifiers required for this chromatin replication. Also localizes to euchromatic regions where it negatively regulates transcription possibly by impacting DNA methylation and histone modifications. Has E3 ubiquitin-protein ligase activity by mediating the ubiquitination of target proteins. However, it is still unclear how E3 ubiquitin-protein ligase activity is related to its role in chromatin in vivo (By similarity). Required for pregastrula and lens development.	confident	E7EZF3
E3 ubiquitin-protein ligase UHRF1	Putative E3 ubiquitin-protein ligase. May participate in methylation-dependent transcriptional regulation. Binds to inverted 5'-CCAAT-3' box 2 in the TOP2A promoter, and activates TOP2A expression. Important for G1/S transition. May be involved in DNA repair and chromosomal stability.	confident	Q96T88
E3 ubiquitin-protein ligase UHRF1	Multidomain protein that acts as a key epigenetic regulator by bridging DNA methylation and chromatin modification. Specifically recognizes and binds hemimethylated DNA at replication forks via its YDG domain and recruits DNMT1 methyltransferase to ensure faithful propagation of the DNA methylation patterns through DNA replication. In addition to its role in maintenance of DNA methylation, also plays a key role in chromatin modification: through its tudor-like regions and PHD-type zinc fingers, specifically recognizes and binds histone H3 trimethylated at 'Lys-9' (H3K9me3) and unmethylated at 'Arg-2' (H3R2me0), respectively, and recruits chromatin proteins. Enriched in pericentric heterochromatin where it recruits different chromatin modifiers required for this chromatin replication. Also localizes to euchromatic regions where it negatively regulates transcription possibly by impacting DNA methylation and histone modifications. Has E3 ubiquitin-protein ligase activity by mediating the ubiquitination of target proteins such as histone H3 and PML. It is still unclear how E3 ubiquitin-protein ligase activity is related to its role in chromatin in vivo. May be involved in DNA repair.	confident	A7E320

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0010390 [BP]	histone monoubiquitination	probable	GO:0044699, GO:0044267, GO:0044260, GO:0032446, GO:0006325, GO:0071840, GO:0070647, GO:0016043, GO:0071704, GO:0016570, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006513, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0016574, GO:0044237, GO:0043170, GO:0016567, GO:0008150, GO:0016568, GO:0016569
GO:0000987 [MF]	core promoter proximal region sequence-specific DNA binding	probable	GO:0044212, GO:0043565, GO:0097159, GO:0000975, GO:0001067, GO:0001159, GO:0000976, GO:0005488, GO:0003676, GO:0003677, GO:0003674, GO:1901363
GO:0031493 [MF]	nucleosomal histone binding	probable	GO:0042393, GO:0031491, GO:0003674, GO:0005488, GO:0005515, GO:0003682
GO:0008327 [MF]	methyl-CpG binding	probable	GO:0043565, GO:0097159, GO:0000166, GO:0036094, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363, GO:1901265
GO:0016363 [CC]	nuclear matrix	probable	GO:0034399, GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0032270 [BP]	positive regulation of cellular protein metabolic process	probable	GO:0032268, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0031325, GO:0031323, GO:0051247, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0019222, GO:0010604, GO:0050789, GO:0048522
GO:0051865 [BP]	protein autoubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0022627 [CC]	cytosolic small ribosomal subunit	probable	GO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0015935, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0044424, GO:0032991, GO:0043228, GO:0030529, GO:0043226, GO:0044422, GO:0005840
GO:0006281 [BP]	DNA repair	probable	GO:0090304, GO:0034641, GO:0006807, GO:0044699, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0005657 [CC]	replication fork	probable	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0004842 [MF]	ubiquitin-protein ligase activity	probable	GO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0000122 [BP]	negative regulation of transcription from RNA polymerase II promoter	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0005720 [CC]	nuclear heterochromatin	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000792, GO:0000790, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0008283 [BP]	cell proliferation	probable	GO:0008150, GO:0044699
GO:0002088 [BP]	lens development in camera-type eye	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0048731, GO:0008150, GO:0043010, GO:0007275, GO:0044699
GO:0031100 [BP]	organ regeneration	probable	GO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0048856, GO:0031099, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0000791 [CC]	euchromatin	probable	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0000785, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0044729 [MF]	hemi-methylated DNA-binding	probable	GO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:0003690, GO:1901363
GO:0007049 [BP]	cell cycle	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0010216 [BP]	maintenance of DNA methylation	probable	GO:0019222, GO:0090304, GO:0034641, GO:0006807, GO:0050789, GO:1901360, GO:0006306, GO:0006305, GO:0006304, GO:0044260, GO:0040029, GO:0071704, GO:0065007, GO:0032259, GO:0010468, GO:0006139, GO:0060255, GO:0009987, GO:0006725, GO:0043412, GO:0044728, GO:0043414, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0071158 [BP]	positive regulation of cell cycle arrest	probable	GO:0090068, GO:0051726, GO:0010564, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0071156, GO:0048522
GO:0042787 [BP]	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	probable	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0070647, GO:0032446, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0044237, GO:0043170, GO:0016567, GO:0006511
GO:0035064 [MF]	methylated histone residue binding	probable	GO:0042393, GO:0003674, GO:0005488, GO:0005515
GO:0008270 [MF]	zinc ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0006351 [BP]	transcription, DNA-dependent	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0042802 [MF]	identical protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OLN, chain A
Confidence level:very confident
Coverage over the Query: 413-484,496-603
View the alignment between query and template
View the model in PyMOL

Template: 3ASK, chain A
Confidence level:very confident
Coverage over the Query: 128-365
View the alignment between query and template
View the model in PyMOL

Template: 1Z6U, chain A
Confidence level:very confident
Coverage over the Query: 646-764
View the alignment between query and template
View the model in PyMOL

Template: 3U30, chain A
Confidence level:very confident
Coverage over the Query: 1-76
View the alignment between query and template
View the model in PyMOL