Diaphorina citri psyllid: psy1130


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MSGWLTGDYSFKCQPLDLGNHPRTMRIQFVLIMVHAFQLLFIDCNFPKAFIQFVLIMVHAFQLLFIDCNFPKAFVWWIGSHAVMFFFLFRNFYKEQYVKPVKTAKACTQKVPDSVPGKVEVFSTLCLKFGVYSAF
cccccccccEEEEECccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccc
**GWLTGDYSFKCQPLDLGNHPRTMRIQFVLIMVHAFQLLFIDCNFPKAFIQFVLIMVHAFQLLFIDCNFPKAFVWWIGSHAVMFFFLFRNFYKEQYVKPVKTAKA***KVPDSVPGKVEVFSTLCLKFGVY***
xxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGWLTGDYSFKCQPLDLGNHPRTMRIQFVLIMVHAFQLLFIDCNFPKAFIQFVLIMVHAFQLLFIDCNFPKAFVWWIGSHAVMFFFLFRNFYKEQYVKPVKTAKACTQKVPDSVPGKVEVFSTLCLKFGVYSAF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042761 [BP]very long-chain fatty acid biosynthetic processprobableGO:0006633, GO:0006631, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0000038, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted