Diaphorina citri psyllid: psy11347


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290----
CPGTESESAGKVSACQGCPNQSICSSGAAKSVDPGIELVKSHLSNVKHKVLVLSGKGGVGKSTFTNLLARVLAKSNESVDVGVLDLDICGPSMPRMMGLLNEQVHQSASGWSPVFLEENLSVMSIGFLLNSPDDAVIWRGPKKNTMIRQFLSEVDWGNGLEYLLIDTPPGTSDEHLSLVQYLKGLPDIGAIVVTTPQEVSLLDVRKEIDFCRKVNIPIIGVVENMATFVCPKCTKPSEIFPKDSGGAEKMCAELSVPFLGSVPIDPLVTRHCDEGTSAIDTPSACVDAIQQIVQ
cccccccccccccccccccccccccccccccccccHHHHHHccccccEEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEEEccccccccHHHcccccccCECccccCEEEEEccccEEEEEEccccccccCEEEcccHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccHHHHHHHHccccccccccccHHHHHHccccccccccccHHHHHHHHHHc
**********************************GIELVKSHLSNVKHKVLVLSGKGGVGKSTFTNLLARVLAKSNESVDVGVLDLDICGPSMPRMMGLLNEQVHQSASGWSPVFLEENLSVMSIGFLLNSPDDAVIWRGPKKNTMIRQFLSEVDWGNGLEYLLIDTPPGTSDEHLSLVQYLKGLPDIGAIVVTTPQEVSLLDVRKEIDFCRKVNIPIIGVVENMATFVCPKCTKPSEIFPKDSGGAEKMCAELSVPFLGSVPIDPLVTRHCDEGTSAIDTPSACVDAIQQIVQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CPGTESESAGKVSACQGCPNQSICSSGAAKSVDPGIELVKSHLSNVKHKVLVLSGKGGVGKSTFTNLLARVLAKSNESVDVGVLDLDICGPSMPRMMGLLNEQVHQSASGWSPVFLEENLSVMSIGFLLNSPDDAVIWRGPKKNTMIRQFLSEVDWGNGLEYLLIDTPPGTSDEHLSLVQYLKGLPDIGAIVVTTPQEVSLLDVRKEIDFCRKVNIPIIGVVENMATFVCPKCTKPSEIFPKDSGGAEKMCAELSVPFLGSVPIDPLVTRHCDEGTSAIDTPSACVDAIQQIVQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytosolic Fe-S cluster assembly factor NUBP1 homolog Component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for maturation of extramitochondrial Fe/S proteins. May bind and transfer 2 labile 4Fe-4S clusters to target apoproteins.very confidentQ9VJI9
Cytosolic Fe-S cluster assembly factor NUBP1 homolog Component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for maturation of extramitochondrial Fe/S proteins. May bind and transfer 2 labile 4Fe-4S clusters to target apoproteins.very confidentQ29MT7
Cytosolic Fe-S cluster assembly factor nbp35 Component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for maturation of extramitochondrial Fe/S proteins. May bind and transfer 2 labile 4Fe-4S clusters to target apoproteins.very confidentQ5BBC5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0065007 [BP]biological regulationconfidentGO:0008150
GO:0005829 [CC]cytosolconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0051536 [MF]iron-sulfur cluster bindingconfidentGO:0003674, GO:0051540, GO:0005488
GO:0016226 [BP]iron-sulfur cluster assemblyconfidentGO:0022607, GO:0009058, GO:0016043, GO:0031163, GO:0044085, GO:0008150, GO:0008152, GO:0071840
GO:0005886 [CC]plasma membraneconfidentGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0002098 [BP]tRNA wobble uridine modificationprobableGO:0009451, GO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0034470, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0006400, GO:0008033, GO:0009987, GO:0006725, GO:0002097, GO:0043412, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0044237, GO:0043170, GO:0006399, GO:0006396
GO:0016887 [MF]ATPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0016049 [BP]cell growthprobableGO:0008150, GO:0009987, GO:0044763, GO:0040007, GO:0044699
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0051539 [MF]4 iron, 4 sulfur cluster bindingprobableGO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0006879 [BP]cellular iron ion homeostasisprobableGO:0019725, GO:0006875, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0055072, GO:0044763, GO:0008150, GO:0030003, GO:0055065, GO:0055080, GO:0065007, GO:0055082, GO:0065008, GO:0044699
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005506 [MF]iron ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0005815 [CC]microtubule organizing centerprobableGO:0005856, GO:0005575, GO:0015630, GO:0043228, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PH1, chain A
Confidence level:very confident
Coverage over the Query: 36-280
View the alignment between query and template
View the model in PyMOL
Template: 1CP2, chain A
Confidence level:confident
Coverage over the Query: 47-229,242-294
View the alignment between query and template
View the model in PyMOL