Diaphorina citri psyllid: psy1134


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MQLPNVDKLNYYVCRTVWKICIQFNKDFGQHILKNPLIIQSIVDKGAIRPTDTVLEIGPGTGNMTVKILEQAKKVIACEIDPSCKSYFPSLYYFRNLCLQEVPTDFDIKTLIDTVLNEINFADKRARTMDLDDFVLLLATFNKHGIHFA
ccccccccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHcccEEEEECcccccccccccccccccccccccccccHHHHHHHHHHcccHHHHHHcccccHHHHHHHHHHHHcccccc
*****VDKLNYYVCRTVWKICIQFNKDFGQHILKNPLIIQSIVDKGAIRPTDTVLEIGPGTGNMTVKILEQAKKVIACEIDPSCKSYFPSLYYFRNLCLQEVPTDFDIKTLIDTVLNEINFADKRARTMDLDDFVLLLATFNKHGIHFA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLPNVDKLNYYVCRTVWKICIQFNKDFGQHILKNPLIIQSIVDKGAIRPTDTVLEIGPGTGNMTVKILEQAKKVIACEIDPSCKSYFPSLYYFRNLCLQEVPTDFDIKTLIDTVLNEINFADKRARTMDLDDFVLLLATFNKHGIHFA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable dimethyladenosine transferase Specifically dimethylates two adjacent adenosines in the loop of a conserved hairpin near the 3'-end of 18S rRNA in the 40S particle.confidentQ9UNQ2
Probable dimethyladenosine transferase Specifically dimethylates two adjacent adenosines in the loop of a conserved hairpin near the 3'-end of 18S rRNA in the 40S particle.confidentQ9D0D4
Dimethyladenosine transferase Specifically dimethylates two adjacent adenosines in the loop of a conserved hairpin near the 3'-end of 18S rRNA in the 40S particle.confidentP41819

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030686 [CC]90S preribosomeprobableGO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0000154 [BP]rRNA modificationprobableGO:0009451, GO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0006139, GO:0044260, GO:0071840, GO:0042254, GO:0071704, GO:0010467, GO:0006364, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0043412, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0052909 [MF]18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase activityprobableGO:0008649, GO:0003824, GO:0008757, GO:0016433, GO:0016740, GO:0008988, GO:0008173, GO:0008170, GO:0016741, GO:0003674, GO:0008168
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0032502 [BP]developmental processprobableGO:0008150
GO:0003723 [MF]RNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0000179 [MF]rRNA (adenine-N6,N6-)-dimethyltransferase activityprobableGO:0008649, GO:0003824, GO:0008757, GO:0016433, GO:0016740, GO:0008173, GO:0008170, GO:0016741, GO:0003674, GO:0008168

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2H1R, chain A
Confidence level:very confident
Coverage over the Query: 31-92
View the alignment between query and template
View the model in PyMOL
Template: 3HNR, chain A
Confidence level:very confident
Coverage over the Query: 40-124
View the alignment between query and template
View the model in PyMOL
Template: 2H1R, chain A
Confidence level:confident
Coverage over the Query: 114-149
View the alignment between query and template
View the model in PyMOL