Psyllid ID: psy1134


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MQLPNVDKLNYYVCRTVWKICIQFNKDFGQHILKNPLIIQSIVDKGAIRPTDTVLEIGPGTGNMTVKILEQAKKVIACEIDPSCKSYFPSLYYFRNLCLQEVPTDFDIKTLIDTVLNEINFADKRARTMDLDDFVLLLATFNKHGIHFA
ccccccccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHcccEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHcccHHHHHHcccccHHHHHHHHHHHHcccccc
cccccHHHHccHEHHHEEccccEEccccccHHcccHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHccEEEEEccHHHHHHcHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHcccHHHHHHHHHHHHHcccccc
mqlpnvdklnYYVCRTVWKICIQFNKDFgqhilknpLIIQSIvdkgairptdtvleigpgtgnMTVKILEQAKKVIaceidpscksyfpslYYFRNLclqevptdfdiKTLIDTVLNEINFADKRARTMDLDDFVLLLATFNKHGIHFA
mqlpnvdklNYYVCRTVWKICIQFNKDFGQHILKNPLIIQSIVDKGAIRPTDTvleigpgtgnMTVKILEQAKKVIACEIDPSCKSYFPSLYYFRNLCLQEVPTDFDIKTLIDTVLNEINFADKRARTMDLDDFVLLLATFNKHGIHFA
MQLPNVDKLNYYVCRTVWKICIQFNKDFGQHILKNPLIIQSIVDKGAIRPTDTVLEIGPGTGNMTVKILEQAKKVIACEIDPSCKSYFPSLYYFRNLCLQEVPTDFDIKTLIDTVLNEINFADKRARTMDLDDFVLLLATFNKHGIHFA
*****VDKLNYYVCRTVWKICIQFNKDFGQHILKNPLIIQSIVDKGAIRPTDTVLEIGPGTGNMTVKILEQAKKVIACEIDPSCKSYFPSLYYFRNLCLQEVPTDFDIKTLIDTVLNEINFADKRARTMDLDDFVLLLATFNKHGIH**
**************RTVWKICIQFNKDFGQHILKNPLIIQSIVDKGAIRPTDTVLEIGPGTGNMTVKILEQAKKVIACEIDPSCKSYFPSLYYFRNLCLQEVPTDFDIKTLIDTVLNEINFADKRARTMDLDDFVLLLATFNKHGIHFA
MQLPNVDKLNYYVCRTVWKICIQFNKDFGQHILKNPLIIQSIVDKGAIRPTDTVLEIGPGTGNMTVKILEQAKKVIACEIDPSCKSYFPSLYYFRNLCLQEVPTDFDIKTLIDTVLNEINFADKRARTMDLDDFVLLLATFNKHGIHFA
*QLPNVDKLNYYVCRTVWKICIQFNKDFGQHILKNPLIIQSIVDKGAIRPTDTVLEIGPGTGNMTVKILEQAKKVIACEIDPSCKSYFPSLYYFRNLCLQEVPTDFDIKTLIDTVLNEINFADKRARTMDLDDFVLLLATFNKHGIHF*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLPNVDKLNYYVCRTVWKICIQFNKDFGQHILKNPLIIQSIVDKGAIRPTDTVLEIGPGTGNMTVKILEQAKKVIACEIDPSCKSYFPSLYYFRNLCLQEVPTDFDIKTLIDTVLNEINFADKRARTMDLDDFVLLLATFNKHGIHFA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query149 2.2.26 [Sep-21-2011]
Q2KHT8 313 Probable dimethyladenosin yes N/A 0.409 0.194 0.754 2e-22
Q9UNQ2 313 Probable dimethyladenosin yes N/A 0.409 0.194 0.754 2e-22
Q95KJ0 313 Probable dimethyladenosin N/A N/A 0.409 0.194 0.754 2e-22
Q9VAQ5 306 Probable dimethyladenosin yes N/A 0.436 0.212 0.738 2e-22
Q9D0D4 313 Probable dimethyladenosin yes N/A 0.409 0.194 0.737 2e-22
P41819 318 Dimethyladenosine transfe yes N/A 0.402 0.188 0.716 7e-21
Q6FKY3 317 Dimethyladenosine transfe yes N/A 0.402 0.189 0.7 1e-20
Q6BSY5 327 Dimethyladenosine transfe yes N/A 0.402 0.183 0.7 1e-20
P78697 320 Dimethyladenosine transfe yes N/A 0.402 0.187 0.716 2e-20
Q75C90 319 Dimethyladenosine transfe yes N/A 0.402 0.188 0.7 2e-20
>sp|Q2KHT8|DIM1_BOVIN Probable dimethyladenosine transferase OS=Bos taurus GN=DIMT1 PE=2 SV=1 Back     alignment and function desciption
 Score =  104 bits (260), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (88%)

Query: 22 IQFNKDFGQHILKNPLIIQSIVDKGAIRPTDTVLEIGPGTGNMTVKILEQAKKVIACEID 81
          + FN   GQHILKNPLI+ SI+DK A+RPTD VLE+GPGTGNMTVK+LE+AKKVIACE+D
Sbjct: 28 LMFNTGIGQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELD 87

Query: 82 P 82
          P
Sbjct: 88 P 88




Specifically dimethylates two adjacent adenosines in the loop of a conserved hairpin near the 3'-end of 18S rRNA in the 40S particle.
Bos taurus (taxid: 9913)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 8EC: 3
>sp|Q9UNQ2|DIM1_HUMAN Probable dimethyladenosine transferase OS=Homo sapiens GN=DIMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q95KJ0|DIM1_MACFA Probable dimethyladenosine transferase OS=Macaca fascicularis GN=DIMT1 PE=2 SV=1 Back     alignment and function description
>sp|Q9VAQ5|DIM1_DROME Probable dimethyladenosine transferase OS=Drosophila melanogaster GN=CG11837 PE=2 SV=1 Back     alignment and function description
>sp|Q9D0D4|DIM1_MOUSE Probable dimethyladenosine transferase OS=Mus musculus GN=Dimt1 PE=2 SV=1 Back     alignment and function description
>sp|P41819|DIM1_YEAST Dimethyladenosine transferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIM1 PE=1 SV=1 Back     alignment and function description
>sp|Q6FKY3|DIM1_CANGA Dimethyladenosine transferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DIM1 PE=3 SV=1 Back     alignment and function description
>sp|Q6BSY5|DIM1_DEBHA Dimethyladenosine transferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DIM1 PE=3 SV=1 Back     alignment and function description
>sp|P78697|DIM1_KLULA Dimethyladenosine transferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DIM1 PE=3 SV=3 Back     alignment and function description
>sp|Q75C90|DIM1_ASHGO Dimethyladenosine transferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DIM1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
170058055 306 dimethyladenosine transferase [Culex qui 0.442 0.215 0.787 2e-22
156542231 306 PREDICTED: probable dimethyladenosine tr 0.429 0.209 0.781 3e-22
157103251 306 dimethyladenosine transferase [Aedes aeg 0.442 0.215 0.757 6e-22
312371948 294 hypothetical protein AND_20790 [Anophele 0.409 0.207 0.803 6e-22
194745790 306 GF16271 [Drosophila ananassae] gi|190628 0.436 0.212 0.769 7e-22
307211915 306 Probable dimethyladenosine transferase [ 0.469 0.228 0.7 8e-22
195449214 306 GK22567 [Drosophila willistoni] gi|19416 0.463 0.225 0.739 1e-21
307172086 263 Probable dimethyladenosine transferase [ 0.456 0.258 0.75 1e-21
167533147 345 hypothetical protein [Monosiga brevicoll 0.382 0.165 0.75 1e-21
125774831 306 GA11224 [Drosophila pseudoobscura pseudo 0.436 0.212 0.753 2e-21
>gi|170058055|ref|XP_001864755.1| dimethyladenosine transferase [Culex quinquefasciatus] gi|167877296|gb|EDS40679.1| dimethyladenosine transferase [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/66 (78%), Positives = 58/66 (87%)

Query: 17 VWKICIQFNKDFGQHILKNPLIIQSIVDKGAIRPTDTVLEIGPGTGNMTVKILEQAKKVI 76
          V K  I FNKDFGQHILKNPLI+ S+++K A+RPTD VLEIGPGTGNMTVKILE+ KKVI
Sbjct: 16 VAKQGIVFNKDFGQHILKNPLIVTSMLEKAALRPTDVVLEIGPGTGNMTVKILEKVKKVI 75

Query: 77 ACEIDP 82
          ACEIDP
Sbjct: 76 ACEIDP 81




Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|156542231|ref|XP_001600750.1| PREDICTED: probable dimethyladenosine transferase-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|157103251|ref|XP_001647892.1| dimethyladenosine transferase [Aedes aegypti] gi|157126646|ref|XP_001654689.1| dimethyladenosine transferase [Aedes aegypti] gi|108873212|gb|EAT37437.1| AAEL010575-PA [Aedes aegypti] gi|108884724|gb|EAT48949.1| AAEL000076-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|312371948|gb|EFR20006.1| hypothetical protein AND_20790 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|194745790|ref|XP_001955370.1| GF16271 [Drosophila ananassae] gi|190628407|gb|EDV43931.1| GF16271 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|307211915|gb|EFN87842.1| Probable dimethyladenosine transferase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|195449214|ref|XP_002071976.1| GK22567 [Drosophila willistoni] gi|194168061|gb|EDW82962.1| GK22567 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|307172086|gb|EFN63666.1| Probable dimethyladenosine transferase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|167533147|ref|XP_001748254.1| hypothetical protein [Monosiga brevicollis MX1] gi|163773374|gb|EDQ87015.1| predicted protein [Monosiga brevicollis MX1] Back     alignment and taxonomy information
>gi|125774831|ref|XP_001358667.1| GA11224 [Drosophila pseudoobscura pseudoobscura] gi|195145334|ref|XP_002013651.1| GL24250 [Drosophila persimilis] gi|54638406|gb|EAL27808.1| GA11224 [Drosophila pseudoobscura pseudoobscura] gi|194102594|gb|EDW24637.1| GL24250 [Drosophila persimilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
ZFIN|ZDB-GENE-040801-75 306 dimt1l "DIM1 dimethyladenosine 0.402 0.196 0.7 8.1e-35
UNIPROTKB|Q2KHT8 313 DIMT1 "Probable dimethyladenos 0.409 0.194 0.754 1e-34
UNIPROTKB|Q9UNQ2 313 DIMT1 "Probable dimethyladenos 0.409 0.194 0.754 1e-34
UNIPROTKB|I3LLW6 313 DIMT1 "Uncharacterized protein 0.409 0.194 0.754 1e-34
MGI|MGI:1913504 313 Dimt1 "DIM1 dimethyladenosine 0.409 0.194 0.737 1.3e-34
RGD|1311752 313 Dimt1 "DIM1 dimethyladenosine 0.409 0.194 0.737 1.3e-34
UNIPROTKB|E2QUS0 312 DIMT1 "Uncharacterized protein 0.409 0.195 0.737 1.7e-34
FB|FBgn0039627 306 CG11837 [Drosophila melanogast 0.530 0.258 0.637 1.3e-32
SGD|S000006187 318 DIM1 "Essential 18S rRNA dimet 0.402 0.188 0.716 5.9e-29
WB|WBGene00008455 308 E02H1.1 [Caenorhabditis elegan 0.409 0.198 0.688 5.9e-29
ZFIN|ZDB-GENE-040801-75 dimt1l "DIM1 dimethyladenosine transferase 1-like (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 242 (90.2 bits), Expect = 8.1e-35, Sum P(2) = 8.1e-35
 Identities = 42/60 (70%), Positives = 52/60 (86%)

Query:    22 IQFNKDFGQHILKNPLIIQSIVDKGAIRPTDTVLEIGPGTGNMTVKILEQAKKVIACEID 81
             I FN   GQHILKNPL++  I++K A+RPTD VLE+GPGTGNMTVK+LE+AKKV+ACE+D
Sbjct:    21 IMFNTGIGQHILKNPLVVNGIIEKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELD 80


GO:0016433 "rRNA (adenine) methyltransferase activity" evidence=IEA
GO:0000154 "rRNA modification" evidence=IEA
GO:0000179 "rRNA (adenine-N6,N6-)-dimethyltransferase activity" evidence=IEA
GO:0006364 "rRNA processing" evidence=IEA
GO:0008649 "rRNA methyltransferase activity" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
UNIPROTKB|Q2KHT8 DIMT1 "Probable dimethyladenosine transferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UNQ2 DIMT1 "Probable dimethyladenosine transferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LLW6 DIMT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1913504 Dimt1 "DIM1 dimethyladenosine transferase 1-like (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311752 Dimt1 "DIM1 dimethyladenosine transferase 1 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUS0 DIMT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0039627 CG11837 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
SGD|S000006187 DIM1 "Essential 18S rRNA dimethylase (dimethyladenosine transferase)" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
WB|WBGene00008455 E02H1.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q54QK7DIM1_DICDI2, ., 1, ., 1, ., 1, 8, 30.70.40260.1910yesN/A
Q9UNQ2DIM1_HUMAN2, ., 1, ., 1, ., 1, 8, 30.75400.40930.1948yesN/A
P41819DIM1_YEAST2, ., 1, ., 1, ., 1, 8, 30.71660.40260.1886yesN/A
Q75C90DIM1_ASHGO2, ., 1, ., 1, ., 1, 8, 30.70.40260.1880yesN/A
Q6BSY5DIM1_DEBHA2, ., 1, ., 1, ., 1, 8, 30.70.40260.1834yesN/A
Q9VAQ5DIM1_DROME2, ., 1, ., 1, ., 1, 8, 30.73840.43620.2124yesN/A
Q9D0D4DIM1_MOUSE2, ., 1, ., 1, ., 1, 8, 30.73770.40930.1948yesN/A
Q6FKY3DIM1_CANGA2, ., 1, ., 1, ., 1, 8, 30.70.40260.1892yesN/A
P78697DIM1_KLULA2, ., 1, ., 1, ., 1, 8, 30.71660.40260.1875yesN/A
Q2KHT8DIM1_BOVIN2, ., 1, ., 1, ., 1, 8, 30.75400.40930.1948yesN/A
Q6C7H6DIM1_YARLI2, ., 1, ., 1, ., 1, 8, 30.70.40260.1892yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
PTZ00338 294 PTZ00338, PTZ00338, dimethyladenosine transferase- 8e-36
COG0030 259 COG0030, KsgA, Dimethyladenosine transferase (rRNA 2e-21
TIGR00755 253 TIGR00755, ksgA, dimethyladenosine transferase 9e-20
PRK00274 272 PRK00274, ksgA, 16S ribosomal RNA methyltransferas 3e-19
pfam00398 254 pfam00398, RrnaAD, Ribosomal RNA adenine dimethyla 4e-18
PRK14896 258 PRK14896, ksgA, 16S ribosomal RNA methyltransferas 2e-16
smart00650169 smart00650, rADc, Ribosomal RNA adenine dimethylas 3e-16
PTZ00338294 PTZ00338, PTZ00338, dimethyladenosine transferase- 4e-11
PRK14968188 PRK14968, PRK14968, putative methyltransferase; Pr 3e-05
COG2518209 COG2518, Pcm, Protein-L-isoaspartate carboxylmethy 8e-04
>gnl|CDD|240367 PTZ00338, PTZ00338, dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
 Score =  124 bits (314), Expect = 8e-36
 Identities = 45/61 (73%), Positives = 53/61 (86%)

Query: 22 IQFNKDFGQHILKNPLIIQSIVDKGAIRPTDTVLEIGPGTGNMTVKILEQAKKVIACEID 81
          + FNK FGQHILKNPL++  IV+K AI+PTDTVLEIGPGTGN+T K+L+ AKKVIA EID
Sbjct: 8  MVFNKKFGQHILKNPLVLDKIVEKAAIKPTDTVLEIGPGTGNLTEKLLQLAKKVIAIEID 67

Query: 82 P 82
          P
Sbjct: 68 P 68


Length = 294

>gnl|CDD|223109 COG0030, KsgA, Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|233115 TIGR00755, ksgA, dimethyladenosine transferase Back     alignment and domain information
>gnl|CDD|234708 PRK00274, ksgA, 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>gnl|CDD|215900 pfam00398, RrnaAD, Ribosomal RNA adenine dimethylase Back     alignment and domain information
>gnl|CDD|237852 PRK14896, ksgA, 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>gnl|CDD|128898 smart00650, rADc, Ribosomal RNA adenine dimethylases Back     alignment and domain information
>gnl|CDD|240367 PTZ00338, PTZ00338, dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|237872 PRK14968, PRK14968, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|225316 COG2518, Pcm, Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 149
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.66
KOG1270|consensus282 99.55
PRK00274 272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 99.54
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.52
KOG0820|consensus 315 99.51
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 99.49
COG2230 283 Cfa Cyclopropane fatty acid synthase and related m 99.47
PRK14896 258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 99.46
COG0030 259 KsgA Dimethyladenosine transferase (rRNA methylati 99.46
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.44
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 99.43
PRK11207197 tellurite resistance protein TehB; Provisional 99.43
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.42
PRK05785226 hypothetical protein; Provisional 99.41
TIGR00755 253 ksgA dimethyladenosine transferase. Alternate name 99.41
PF02353 273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.41
COG4976287 Predicted methyltransferase (contains TPR repeat) 99.39
PTZ00098 263 phosphoethanolamine N-methyltransferase; Provision 99.38
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.38
PLN02233261 ubiquinone biosynthesis methyltransferase 99.38
PRK10258 251 biotin biosynthesis protein BioC; Provisional 99.36
PLN02585315 magnesium protoporphyrin IX methyltransferase 99.36
PLN02244 340 tocopherol O-methyltransferase 99.36
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.36
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.36
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.36
COG4106 257 Tam Trans-aconitate methyltransferase [General fun 99.35
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 99.34
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.34
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.34
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.33
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.33
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.32
PRK12335287 tellurite resistance protein TehB; Provisional 99.32
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 99.3
PRK06202232 hypothetical protein; Provisional 99.28
PRK11705 383 cyclopropane fatty acyl phospholipid synthase; Pro 99.28
TIGR00452314 methyltransferase, putative. Known examples to dat 99.25
PF00398 262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 99.25
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.24
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.23
PLN02336475 phosphoethanolamine N-methyltransferase 99.22
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.22
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.22
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.22
KOG1541|consensus 270 99.21
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 99.18
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.18
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.18
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.16
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 99.15
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.13
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 99.13
PRK08317 241 hypothetical protein; Provisional 99.13
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.12
smart00650169 rADc Ribosomal RNA adenine dimethylases. 99.11
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.1
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.1
PLN02490 340 MPBQ/MSBQ methyltransferase 99.1
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.09
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 99.09
smart00828 224 PKS_MT Methyltransferase in polyketide synthase (P 99.08
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 99.08
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.08
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.07
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.06
PLN02336 475 phosphoethanolamine N-methyltransferase 99.05
PRK07402196 precorrin-6B methylase; Provisional 99.05
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.05
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.04
PHA03412241 putative methyltransferase; Provisional 99.03
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.03
COG4123248 Predicted O-methyltransferase [General function pr 99.02
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.02
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.01
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 99.01
PRK14967223 putative methyltransferase; Provisional 99.01
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.0
PRK04148134 hypothetical protein; Provisional 98.95
KOG1540|consensus296 98.95
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 98.94
PRK06922 677 hypothetical protein; Provisional 98.93
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 98.93
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 98.93
COG2263198 Predicted RNA methylase [Translation, ribosomal st 98.92
PHA03411 279 putative methyltransferase; Provisional 98.92
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 98.92
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.91
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 98.9
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.9
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.89
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.88
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.88
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 98.88
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.87
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.87
PRK14968188 putative methyltransferase; Provisional 98.86
TIGR03438 301 probable methyltransferase. This model represents 98.85
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.85
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 98.84
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 98.84
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.83
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 98.83
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.83
PRK04266226 fibrillarin; Provisional 98.81
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 98.8
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.79
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.79
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.78
PRK04457262 spermidine synthase; Provisional 98.76
COG2890280 HemK Methylase of polypeptide chain release factor 98.75
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 98.73
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 98.72
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.72
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.72
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.72
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.71
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.71
PRK00811 283 spermidine synthase; Provisional 98.7
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.7
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.69
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.68
KOG1500|consensus 517 98.67
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 98.67
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 98.67
KOG3010|consensus 261 98.66
KOG1271|consensus227 98.66
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.65
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.65
KOG3420|consensus185 98.65
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 98.65
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.65
KOG1499|consensus 346 98.63
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 98.63
KOG2361|consensus264 98.62
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 98.6
PRK11727 321 23S rRNA mA1618 methyltransferase; Provisional 98.58
COG1041347 Predicted DNA modification methylase [DNA replicat 98.58
PF02384 311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 98.58
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 98.57
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.56
KOG4300|consensus252 98.55
PRK10901427 16S rRNA methyltransferase B; Provisional 98.54
PLN03075296 nicotianamine synthase; Provisional 98.53
COG2265432 TrmA SAM-dependent methyltransferases related to t 98.52
PLN02366 308 spermidine synthase 98.49
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.49
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.48
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 98.47
PLN02476278 O-methyltransferase 98.45
PRK14904445 16S rRNA methyltransferase B; Provisional 98.45
KOG2904|consensus328 98.45
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.44
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.44
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.44
TIGR00438188 rrmJ cell division protein FtsJ. 98.43
PRK14902444 16S rRNA methyltransferase B; Provisional 98.43
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.42
PRK01581 374 speE spermidine synthase; Validated 98.41
KOG2899|consensus 288 98.4
PRK14903431 16S rRNA methyltransferase B; Provisional 98.4
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.39
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.38
KOG2187|consensus534 98.38
PTZ00146293 fibrillarin; Provisional 98.38
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 98.37
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 98.37
PRK14901434 16S rRNA methyltransferase B; Provisional 98.36
PLN02672 1082 methionine S-methyltransferase 98.34
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.34
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 98.33
PRK03612 521 spermidine synthase; Provisional 98.32
PF13679141 Methyltransf_32: Methyltransferase domain 98.3
PF08704 247 GCD14: tRNA methyltransferase complex GCD14 subuni 98.29
COG4122219 Predicted O-methyltransferase [General function pr 98.28
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.27
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.26
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 98.21
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 98.21
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 98.18
COG2521287 Predicted archaeal methyltransferase [General func 98.18
PF03291 331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 98.17
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.17
COG1092393 Predicted SAM-dependent methyltransferases [Genera 98.16
PLN02589247 caffeoyl-CoA O-methyltransferase 98.13
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 98.13
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 98.11
KOG3191|consensus209 98.08
COG2520341 Predicted methyltransferase [General function pred 98.05
KOG3987|consensus288 97.99
PF09243 274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 97.98
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.94
PRK11524284 putative methyltransferase; Provisional 97.92
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 97.91
COG0742187 N6-adenine-specific methylase [DNA replication, re 97.91
COG4076 252 Predicted RNA methylase [General function predicti 97.9
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 97.87
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 97.8
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 97.77
PRK13699227 putative methylase; Provisional 97.73
COG0421282 SpeE Spermidine synthase [Amino acid transport and 97.7
KOG2915|consensus314 97.7
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 97.64
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 97.63
KOG1661|consensus237 97.62
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 97.55
PRK10611287 chemotaxis methyltransferase CheR; Provisional 97.55
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 97.46
PHA01634156 hypothetical protein 97.46
COG3897218 Predicted methyltransferase [General function pred 97.44
TIGR03439 319 methyl_EasF probable methyltransferase domain, Eas 97.44
PLN02823 336 spermine synthase 97.4
KOG2730|consensus263 97.38
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 97.37
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 97.32
PF11599246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 97.32
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 97.31
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 97.21
KOG1663|consensus237 97.21
COG0286 489 HsdM Type I restriction-modification system methyl 97.18
KOG2078|consensus 495 97.17
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 97.14
PRK10742250 putative methyltransferase; Provisional 97.13
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 97.09
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 97.09
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 97.07
COG1565 370 Uncharacterized conserved protein [Function unknow 97.03
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 97.0
KOG2940|consensus 325 96.97
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 96.93
COG0500 257 SmtA SAM-dependent methyltransferases [Secondary m 96.89
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 96.89
KOG4058|consensus199 96.8
KOG1975|consensus 389 96.8
KOG0821|consensus 326 96.8
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 96.7
PRK00536262 speE spermidine synthase; Provisional 96.69
PF07942 270 N2227: N2227-like protein; InterPro: IPR012901 Thi 96.58
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 96.44
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 96.34
KOG3115|consensus249 96.27
PF04816 205 DUF633: Family of unknown function (DUF633) ; Inte 96.15
KOG1501|consensus 636 96.13
KOG4589|consensus232 96.13
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 96.04
KOG2920|consensus282 95.95
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 95.89
KOG2651|consensus 476 95.85
PF02636 252 Methyltransf_28: Putative S-adenosyl-L-methionine- 95.82
KOG2671|consensus 421 95.72
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 95.63
COG2384 226 Predicted SAM-dependent methyltransferase [General 95.62
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 95.58
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 95.56
PLN02232160 ubiquinone biosynthesis methyltransferase 95.48
KOG3045|consensus325 95.45
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 95.44
PF02086 260 MethyltransfD12: D12 class N6 adenine-specific DNA 95.44
KOG1227|consensus351 95.31
COG0863302 DNA modification methylase [DNA replication, recom 95.0
COG4262 508 Predicted spermidine synthase with an N-terminal m 94.93
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 94.91
cd00315 275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 94.84
COG0275 314 Predicted S-adenosylmethionine-dependent methyltra 94.7
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 94.61
PF11899 380 DUF3419: Protein of unknown function (DUF3419); In 94.46
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 94.23
KOG1709|consensus271 93.45
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 93.37
KOG1331|consensus 293 93.31
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 93.27
KOG0024|consensus354 93.22
PF00145 335 DNA_methylase: C-5 cytosine-specific DNA methylase 93.21
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 93.17
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 93.09
PF05050167 Methyltransf_21: Methyltransferase FkbM domain; In 92.97
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 92.33
KOG1269|consensus 364 92.33
KOG2798|consensus 369 92.15
PF05206 259 TRM13: Methyltransferase TRM13; InterPro: IPR00787 92.0
COG3129 292 Predicted SAM-dependent methyltransferase [General 91.56
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 90.8
KOG3178|consensus342 90.29
TIGR00675 315 dcm DNA-methyltransferase (dcm). All proteins in t 90.11
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 90.0
KOG3924|consensus 419 89.74
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 89.03
KOG2793|consensus248 88.67
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 88.42
COG5379 414 BtaA S-adenosylmethionine:diacylglycerol 3-amino-3 88.25
KOG1098|consensus 780 88.1
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 88.0
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 87.93
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 87.69
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 87.64
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 87.59
PLN02668 386 indole-3-acetate carboxyl methyltransferase 87.42
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 87.24
TIGR00497 501 hsdM type I restriction system adenine methylase ( 87.13
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, 86.87
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 86.81
PF02005 377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 86.23
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 86.06
PF12692160 Methyltransf_17: S-adenosyl-L-methionine methyltra 85.08
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 84.87
KOG3201|consensus201 84.56
PRK09880343 L-idonate 5-dehydrogenase; Provisional 83.88
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 83.77
COG3510237 CmcI Cephalosporin hydroxylase [Defense mechanisms 83.66
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 82.9
COG5459 484 Predicted rRNA methylase [Translation, ribosomal s 82.67
PRK10458 467 DNA cytosine methylase; Provisional 82.6
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 81.52
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 81.41
KOG2352|consensus482 81.25
PF03686127 UPF0146: Uncharacterised protein family (UPF0146); 81.18
PF05575 286 V_cholerae_RfbT: Vibrio cholerae RfbT protein; Int 81.01
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 80.99
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 80.92
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 80.79
KOG0022|consensus375 80.68
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 80.41
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 80.28
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 80.15
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
Probab=99.66  E-value=6.3e-16  Score=113.32  Aligned_cols=127  Identities=17%  Similarity=0.216  Sum_probs=88.2

Q ss_pred             chhhHHHHHHHhhcccccc---cccccccCHHHHHHHHHHcCC---CCCCeEEEEcCCcchhHHHHHhcCCeEEEEeCCh
Q psy1134           9 LNYYVCRTVWKICIQFNKD---FGQHILKNPLIIQSIVDKGAI---RPTDTVLEIGPGTGNMTVKILEQAKKVIACEIDP   82 (149)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~~---~g~~~~~~~~~~~~~~~~l~~---~~~~~vLDiGcG~G~~~~~l~~~~~~v~giD~s~   82 (149)
                      .++.....+.+....|-..   +.+....++.....+......   ..+.+|||+|||.|+++.++|+.|+.|+|+|+++
T Consensus        12 id~~e~~~F~~la~~wwd~~g~f~~LH~~N~~rl~~i~~~~~~~~~l~g~~vLDvGCGgG~Lse~mAr~Ga~VtgiD~se   91 (243)
T COG2227          12 VDYKELDKFEALASRWWDPEGEFKPLHKINPLRLDYIREVARLRFDLPGLRVLDVGCGGGILSEPLARLGASVTGIDASE   91 (243)
T ss_pred             CCHHHHHHHHHHHhhhcCCCCceeeeeeeccchhhhhhhhhhcccCCCCCeEEEecCCccHhhHHHHHCCCeeEEecCCh
Confidence            3444555555544444322   333333444444444444432   4788999999999999999999999999999999


Q ss_pred             hHHhhhhhhhcccCee-------ecc---CCCCCcchhhHHHHhccccchhHhhccCChhhHHHHHHhhhccC
Q psy1134          83 SCKSYFPSLYYFRNLC-------LQE---VPTDFDIKTLIDTVLNEINFADKRARTMDLDDFVLLLATFNKHG  145 (149)
Q Consensus        83 ~~i~~a~~~~~~~~~~-------~~~---~~~~~d~v~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  145 (149)
                      ++|+.|+.+.....+.       .+.   ..++||+|+|. .+++|.+++         ..|++-++.+-++|
T Consensus        92 ~~I~~Ak~ha~e~gv~i~y~~~~~edl~~~~~~FDvV~cm-EVlEHv~dp---------~~~~~~c~~lvkP~  154 (243)
T COG2227          92 KPIEVAKLHALESGVNIDYRQATVEDLASAGGQFDVVTCM-EVLEHVPDP---------ESFLRACAKLVKPG  154 (243)
T ss_pred             HHHHHHHHhhhhccccccchhhhHHHHHhcCCCccEEEEh-hHHHccCCH---------HHHHHHHHHHcCCC
Confidence            9999999775443333       222   22699999999 999999975         44777777776655



>KOG1270|consensus Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0820|consensus Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>KOG1541|consensus Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG1540|consensus Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>KOG1500|consensus Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>KOG3010|consensus Back     alignment and domain information
>KOG1271|consensus Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>KOG3420|consensus Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>KOG1499|consensus Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG2361|consensus Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>KOG4300|consensus Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG2904|consensus Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>KOG2899|consensus Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2187|consensus Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>KOG3191|consensus Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3987|consensus Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2915|consensus Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>KOG1661|consensus Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>KOG2730|consensus Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>KOG1663|consensus Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>KOG2078|consensus Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>COG1565 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>KOG2940|consensus Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>KOG4058|consensus Back     alignment and domain information
>KOG1975|consensus Back     alignment and domain information
>KOG0821|consensus Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>KOG3115|consensus Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>KOG1501|consensus Back     alignment and domain information
>KOG4589|consensus Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>KOG2920|consensus Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2651|consensus Back     alignment and domain information
>PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function Back     alignment and domain information
>KOG2671|consensus Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>KOG3045|consensus Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02086 MethyltransfD12: D12 class N6 adenine-specific DNA methyltransferase; InterPro: IPR012327 In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes Back     alignment and domain information
>KOG1227|consensus Back     alignment and domain information
>COG0863 DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>KOG1709|consensus Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG1331|consensus Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF05050 Methyltransf_21: Methyltransferase FkbM domain; InterPro: IPR007744 This entry contains proteins of unknown function Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>KOG1269|consensus Back     alignment and domain information
>KOG2798|consensus Back     alignment and domain information
>PF05206 TRM13: Methyltransferase TRM13; InterPro: IPR007871 This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [] Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>KOG3178|consensus Back     alignment and domain information
>TIGR00675 dcm DNA-methyltransferase (dcm) Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>KOG3924|consensus Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>KOG2793|consensus Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>COG5379 BtaA S-adenosylmethionine:diacylglycerol 3-amino-3-carboxypropyl transferase [Lipid metabolism] Back     alignment and domain information
>KOG1098|consensus Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00497 hsdM type I restriction system adenine methylase (hsdM) Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PF12692 Methyltransf_17: S-adenosyl-L-methionine methyltransferase; PDB: 3IHT_B Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>KOG3201|consensus Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>COG3510 CmcI Cephalosporin hydroxylase [Defense mechanisms] Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>KOG2352|consensus Back     alignment and domain information
>PF03686 UPF0146: Uncharacterised protein family (UPF0146); InterPro: IPR005353 The function of this family of proteins is unknown Back     alignment and domain information
>PF05575 V_cholerae_RfbT: Vibrio cholerae RfbT protein; InterPro: IPR008890 This family consists of several RfbT proteins from Vibrio cholerae Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>KOG0022|consensus Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
1zq9_A 285 Crystal Structure Of Human Dimethyladenosine Transf 2e-22
1zq9_A285 Crystal Structure Of Human Dimethyladenosine Transf 1e-09
2h1r_A 299 Crystal Structure Of A Dimethyladenosine Transferas 3e-11
2h1r_A299 Crystal Structure Of A Dimethyladenosine Transferas 3e-05
3tqs_A 255 Structure Of The Dimethyladenosine Transferase (Ksg 2e-06
3r9x_B 248 Crystal Structure Of Era In Complex With Mggdpnp, N 7e-06
3ftc_A 249 Crystal Structure Of A. Aeolicus Ksga At 1.72-Angst 7e-06
1yub_A 245 Solution Structure Of An Rrna Methyltransferase (Er 3e-05
3fuu_A 271 T. Thermophilus 16s Rrna A1518 And A1519 Methyltran 1e-04
3fut_A 271 Apo-Form Of T. Thermophilus 16s Rrna A1518 And A151 1e-04
3grr_A 295 Crystal Structure Of The Complex Between S-Adenosyl 3e-04
>pdb|1ZQ9|A Chain A, Crystal Structure Of Human Dimethyladenosine Transferase Length = 285 Back     alignment and structure

Iteration: 1

Score = 101 bits (251), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 45/58 (77%), Positives = 52/58 (89%) Query: 25 NKDFGQHILKNPLIIQSIVDKGAIRPTDTVLEIGPGTGNMTVKILEQAKKVIACEIDP 82 N GQHILKNPLII SI+DK A+RPTD VLE+GPGTGNMTVK+LE+AKKV+ACE+DP Sbjct: 3 NTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDP 60
>pdb|1ZQ9|A Chain A, Crystal Structure Of Human Dimethyladenosine Transferase Length = 285 Back     alignment and structure
>pdb|2H1R|A Chain A, Crystal Structure Of A Dimethyladenosine Transferase From Plasmodium Falciparum Length = 299 Back     alignment and structure
>pdb|2H1R|A Chain A, Crystal Structure Of A Dimethyladenosine Transferase From Plasmodium Falciparum Length = 299 Back     alignment and structure
>pdb|3TQS|A Chain A, Structure Of The Dimethyladenosine Transferase (Ksga) From Coxiella Burnetii Length = 255 Back     alignment and structure
>pdb|3R9X|B Chain B, Crystal Structure Of Era In Complex With Mggdpnp, Nucleotides 1506- 1542 Of 16s Ribosomal Rna, And Ksga Length = 248 Back     alignment and structure
>pdb|3FTC|A Chain A, Crystal Structure Of A. Aeolicus Ksga At 1.72-Angstrom Resolution Length = 249 Back     alignment and structure
>pdb|1YUB|A Chain A, Solution Structure Of An Rrna Methyltransferase (Ermam) That Confers Macrolide-Lincosamide-Streptogramin Antibiotic Resistance, Nmr, Minimized Average Structure Length = 245 Back     alignment and structure
>pdb|3FUU|A Chain A, T. Thermophilus 16s Rrna A1518 And A1519 Methyltransferase (Ksga) In Complex With Adenosine In Space Group P212121 Length = 271 Back     alignment and structure
>pdb|3FUT|A Chain A, Apo-Form Of T. Thermophilus 16s Rrna A1518 And A1519 Methyltransferase (Ksga) In Space Group P21212 Length = 271 Back     alignment and structure
>pdb|3GRR|A Chain A, Crystal Structure Of The Complex Between S-Adenosyl Homocysteine And Methanocaldococcus Jannaschi Dim1. Length = 295 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 5e-31
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 6e-11
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 3e-30
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 1e-11
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 1e-25
1yub_A 245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 6e-20
3tqs_A 255 Ribosomal RNA small subunit methyltransferase A; p 2e-19
1qam_A 244 ERMC' methyltransferase; rRNA methyltransferase ER 2e-19
3ftd_A 249 Dimethyladenosine transferase; KSGA, rossmann-like 2e-18
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 4e-18
3uzu_A 279 Ribosomal RNA small subunit methyltransferase A; s 3e-17
3fut_A 271 Dimethyladenosine transferase; methyltransferase, 6e-17
1qyr_A 252 KSGA, high level kasugamycin resistance protein, S 8e-16
3hnr_A220 Probable methyltransferase BT9727_4108; structural 2e-06
3ege_A 261 Putative methyltransferase from antibiotic biosyn 5e-06
3i9f_A170 Putative type 11 methyltransferase; structural gen 8e-06
3dh0_A219 SAM dependent methyltransferase; cystal structure, 1e-05
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 1e-05
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 4e-05
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 6e-05
1xxl_A 239 YCGJ protein; structural genomics, protein structu 6e-05
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 7e-05
3m33_A226 Uncharacterized protein; structural genomics, PSI- 7e-05
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 7e-05
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 1e-04
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 1e-04
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 1e-04
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 1e-04
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 2e-04
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 2e-04
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 2e-04
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 5e-04
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 8e-04
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Length = 285 Back     alignment and structure
 Score =  111 bits (280), Expect = 5e-31
 Identities = 45/58 (77%), Positives = 52/58 (89%)

Query: 25 NKDFGQHILKNPLIIQSIVDKGAIRPTDTVLEIGPGTGNMTVKILEQAKKVIACEIDP 82
          N   GQHILKNPLII SI+DK A+RPTD VLE+GPGTGNMTVK+LE+AKKV+ACE+DP
Sbjct: 3  NTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDP 60


>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Length = 285 Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Length = 299 Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Length = 299 Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Length = 295 Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Length = 245 Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} Length = 255 Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Length = 244 Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Length = 249 Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Length = 353 Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Length = 279 Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Length = 271 Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Length = 252 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Length = 220 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Length = 263 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Length = 218 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Length = 192 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Length = 185 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Length = 277 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Length = 204 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Length = 248 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Length = 183 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Length = 279 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Length = 210 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Length = 275 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Length = 245 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
3fut_A 271 Dimethyladenosine transferase; methyltransferase, 99.65
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 99.59
3tqs_A 255 Ribosomal RNA small subunit methyltransferase A; p 99.57
3uzu_A 279 Ribosomal RNA small subunit methyltransferase A; s 99.55
3ftd_A 249 Dimethyladenosine transferase; KSGA, rossmann-like 99.55
3iv6_A 261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.53
1qam_A 244 ERMC' methyltransferase; rRNA methyltransferase ER 99.52
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.48
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 99.48
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.48
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 99.48
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.46
4hg2_A 257 Methyltransferase type 11; structural genomics, PS 99.46
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.45
3ege_A 261 Putative methyltransferase from antibiotic biosyn 99.44
3g5l_A 253 Putative S-adenosylmethionine dependent methyltran 99.44
3thr_A 293 Glycine N-methyltransferase; GNMT, folate, methylt 99.43
1yub_A 245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 99.42
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.42
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.42
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.42
3ujc_A 266 Phosphoethanolamine N-methyltransferase; parasite; 99.41
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; H 99.41
2p7i_A 250 Hypothetical protein; putative methyltransferase, 99.41
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.41
3pfg_A 263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.41
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.4
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.4
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.4
3g2m_A 299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.4
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.39
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.39
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.39
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.39
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.38
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 99.38
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 99.38
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.37
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.37
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.37
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 99.36
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 99.36
3f4k_A257 Putative methyltransferase; structural genomics, P 99.35
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.35
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 99.35
4htf_A 285 S-adenosylmethionine-dependent methyltransferase; 99.34
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.34
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.34
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.33
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.33
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.32
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.32
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.32
1y8c_A 246 S-adenosylmethionine-dependent methyltransferase; 99.31
1wzn_A 252 SAM-dependent methyltransferase; structural genomi 99.31
1qyr_A 252 KSGA, high level kasugamycin resistance protein, S 99.31
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.31
2o57_A 297 Putative sarcosine dimethylglycine methyltransfera 99.3
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.3
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 99.3
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 99.3
1xxl_A 239 YCGJ protein; structural genomics, protein structu 99.3
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.29
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.27
3d2l_A 243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.27
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.26
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.26
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.26
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.26
2avn_A 260 Ubiquinone/menaquinone biosynthesis methyltransfe 99.25
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.25
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.25
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 99.24
3lcc_A235 Putative methyl chloride transferase; halide methy 99.24
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.24
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.23
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.23
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.23
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.21
2a14_A 263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.21
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.21
2aot_A 292 HMT, histamine N-methyltransferase; classic methyl 99.2
3cc8_A230 Putative methyltransferase; structural genomics, j 99.2
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.19
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.19
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.18
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.18
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.17
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.17
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.17
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.17
2g72_A 289 Phenylethanolamine N-methyltransferase; HET: SAM F 99.16
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.16
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 99.16
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.15
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.14
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.14
3bzb_A 281 Uncharacterized protein; RED ALGA, protein structu 99.14
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 99.14
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.14
2i62_A 265 Nicotinamide N-methyltransferase; structural genom 99.13
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.13
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 99.13
3hp7_A 291 Hemolysin, putative; structural genomics, APC64019 99.12
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.12
3ocj_A305 Putative exported protein; structural genomics, PS 99.11
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.1
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.1
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 99.1
3lpm_A 259 Putative methyltransferase; structural genomics, p 99.09
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.09
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.08
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.08
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.08
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.08
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 99.07
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.06
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.06
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 99.05
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 99.05
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.05
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.05
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.05
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.04
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.04
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.04
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.04
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.03
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.03
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 99.03
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.03
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 99.03
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.03
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.02
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.02
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 99.02
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.02
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.02
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.02
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.02
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.01
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.01
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 99.0
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.0
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 98.99
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 98.99
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 98.98
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.98
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 98.98
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 98.98
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 98.98
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 98.97
3adn_A 294 Spermidine synthase; aminopropyltransferase, polya 98.97
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 98.97
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.96
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 98.96
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.96
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 98.96
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 98.95
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 98.95
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 98.95
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 98.95
2h00_A254 Methyltransferase 10 domain containing protein; st 98.95
2avd_A229 Catechol-O-methyltransferase; structural genomics, 98.95
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 98.94
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 98.93
3kr9_A 225 SAM-dependent methyltransferase; class I rossmann- 98.93
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 98.93
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 98.93
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 98.93
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 98.93
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 98.92
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.92
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.92
3gnl_A 244 Uncharacterized protein, DUF633, LMOF2365_1472; st 98.91
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 98.91
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 98.91
1jsx_A207 Glucose-inhibited division protein B; methyltransf 98.9
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.9
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 98.9
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 98.9
2r3s_A335 Uncharacterized protein; methyltransferase domain, 98.9
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.9
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 98.9
3bwc_A 304 Spermidine synthase; SAM, SGPP, structura genomics 98.9
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 98.89
3lec_A 230 NADB-rossmann superfamily protein; PSI, MCSG, stru 98.89
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 98.89
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 98.89
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 98.89
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.88
2o07_A 304 Spermidine synthase; structural genomics, structur 98.88
2b3t_A276 Protein methyltransferase HEMK; translation termin 98.88
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.88
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 98.88
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 98.87
1mjf_A 281 Spermidine synthase; spermidine synthetase, struct 98.87
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.87
2ozv_A 260 Hypothetical protein ATU0636; structural genomics, 98.87
2b78_A385 Hypothetical protein SMU.776; structure genomics, 98.87
1yb2_A275 Hypothetical protein TA0852; structural genomics, 98.87
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.87
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.86
3k6r_A278 Putative transferase PH0793; structural genomics, 98.86
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 98.86
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 98.86
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 98.86
2i7c_A 283 Spermidine synthase; transferase, structural genom 98.85
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.85
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.85
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813 98.85
3dp7_A363 SAM-dependent methyltransferase; structural genomi 98.85
2b25_A 336 Hypothetical protein; structural genomics, methyl 98.84
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 98.84
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 98.84
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.84
1xj5_A 334 Spermidine synthase 1; structural genomics, protei 98.84
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 98.84
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 98.84
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 98.83
2pt6_A 321 Spermidine synthase; transferase, structural genom 98.82
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.82
1inl_A 296 Spermidine synthase; beta-barrel, rossman fold, st 98.82
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.8
1uir_A 314 Polyamine aminopropyltransferase; spermidien synth 98.8
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.8
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.79
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 98.79
2b2c_A 314 Spermidine synthase; beta-alpha, transferase; 2.50 98.78
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 98.76
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.76
2zig_A297 TTHA0409, putative modification methylase; methylt 98.75
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.75
3gjy_A 317 Spermidine synthase; APC62791, structural genomics 98.74
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 98.73
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 98.73
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 98.72
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 98.72
2f8l_A 344 Hypothetical protein LMO1582; structural genomics, 98.72
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.71
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 98.7
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 98.7
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 98.69
3ll7_A 410 Putative methyltransferase; methytransferase, stru 98.68
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 98.68
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.68
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 98.67
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.66
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 98.66
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.65
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 98.63
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.62
3lkd_A 542 Type I restriction-modification system methyltrans 98.61
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 98.6
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 98.6
2qm3_A 373 Predicted methyltransferase; putative methyltransf 98.56
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 98.56
2p41_A 305 Type II methyltransferase; vizier, viral enzymes i 98.56
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.55
3giw_A277 Protein of unknown function DUF574; rossmann-fold 98.55
3khk_A 544 Type I restriction-modification system methylation 98.54
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.53
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.53
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.51
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.47
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.46
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 98.45
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.43
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 98.4
2b9e_A 309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 98.4
1wg8_A 285 Predicted S-adenosylmethionine-dependent methyltra 98.35
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 98.34
3sso_A419 Methyltransferase; macrolide, natural product, ros 98.33
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 98.32
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.27
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.27
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.19
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.17
3ufb_A 530 Type I restriction-modification system methyltran 98.13
2xyq_A 290 Putative 2'-O-methyl transferase; transferase-vira 97.95
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 97.83
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 97.77
3cvo_A202 Methyltransferase-like protein of unknown functio; 97.73
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 97.67
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 97.66
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 97.64
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 97.58
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 97.56
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 97.55
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 97.36
3evf_A 277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 97.33
3lkz_A 321 Non-structural protein 5; flavivirus, methyltransf 97.32
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 97.23
2py6_A409 Methyltransferase FKBM; YP_546752.1, structural ge 97.18
4fzv_A 359 Putative methyltransferase NSUN4; mterf fold, meth 96.86
3eld_A 300 Methyltransferase; flavivirus, RNA capping, guanyl 96.77
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 96.57
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 96.47
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 96.25
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 95.94
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 95.85
2px2_A269 Genome polyprotein [contains: capsid protein C (co 95.77
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase 95.77
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 95.46
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 95.37
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 95.03
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 94.88
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 94.88
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 94.86
3qv2_A 327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 94.81
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 94.8
4f3n_A 432 Uncharacterized ACR, COG1565 superfamily; structur 94.61
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 94.47
1zkd_A 387 DUF185; NESG, RPR58, structural genomics, PSI, pro 94.4
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 94.3
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 94.27
2qrv_A 295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 94.11
3gms_A340 Putative NADPH:quinone reductase; structural genom 94.02
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 94.01
4h0n_A 333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 93.96
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 93.89
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 93.88
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 93.87
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 93.85
2oo3_A283 Protein involved in catabolism of external DNA; st 93.78
3ubt_Y 331 Modification methylase HAEIII; protein-DNA complex 93.75
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 93.73
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 93.61
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 93.6
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 93.54
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 93.52
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 93.31
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 93.27
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 93.11
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 93.1
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 92.98
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 92.81
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 92.68
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 92.26
3me5_A 482 Cytosine-specific methyltransferase; structural ge 92.09
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 92.0
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 91.85
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 91.78
4eye_A342 Probable oxidoreductase; structural genomics, niai 91.6
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 91.58
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 91.52
3r24_A 344 NSP16, 2'-O-methyl transferase; methyltransferase, 91.47
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 91.41
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 91.38
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 91.36
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 91.21
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 91.1
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 91.01
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 91.01
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 90.99
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 90.92
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 90.89
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 90.7
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 90.09
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 89.77
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 89.47
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 88.97
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 88.68
3iht_A174 S-adenosyl-L-methionine methyl transferase; YP_165 88.54
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 88.2
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 88.02
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 87.58
4dkj_A 403 Cytosine-specific methyltransferase; CG-specificit 87.52
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 87.31
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 87.28
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 87.2
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 87.1
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 86.74
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 86.19
1lss_A140 TRK system potassium uptake protein TRKA homolog; 85.73
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 85.69
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 85.67
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 85.6
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 85.19
2dpm_A 284 M.dpnii 1, protein (adenine-specific methyltransfe 84.66
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 84.57
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 84.48
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 84.38
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 84.3
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 84.21
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 84.12
3fbg_A346 Putative arginate lyase; structural genomics, unkn 83.94
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 83.48
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 83.44
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 82.89
3iup_A 379 Putative NADPH:quinone oxidoreductase; YP_296108.1 82.48
1rjd_A 334 PPM1P, carboxy methyl transferase for protein phos 82.46
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 81.85
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 81.72
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 81.55
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 81.54
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 81.37
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 80.95
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 80.81
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 80.53
2g1p_A 278 DNA adenine methylase; DAM methylation, GATC recog 80.48
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
Probab=99.65  E-value=5.9e-16  Score=116.12  Aligned_cols=86  Identities=24%  Similarity=0.279  Sum_probs=78.1

Q ss_pred             hHHHHHHHhhcccccccccccccCHHHHHHHHHHcCCCCCCeEEEEcCCcchhHHHHHhcCCeEEEEeCChhHHhhhhhh
Q psy1134          12 YVCRTVWKICIQFNKDFGQHILKNPLIIQSIVDKGAIRPTDTVLEIGPGTGNMTVKILEQAKKVIACEIDPSCKSYFPSL   91 (149)
Q Consensus        12 ~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~l~~~~~~~vLDiGcG~G~~~~~l~~~~~~v~giD~s~~~i~~a~~~   91 (149)
                      -....++.++..+++++||+|..++.+.+++++.+...++ +|||||||+|.+|..+++.+.+|+|+|+|++|++.++++
T Consensus         9 ~~~~~~~~~~~~~~k~~GQnfL~d~~i~~~Iv~~~~~~~~-~VLEIG~G~G~lt~~L~~~~~~V~avEid~~~~~~l~~~   87 (271)
T 3fut_A            9 SVRALLERHGLFADKRFGQNFLVSEAHLRRIVEAARPFTG-PVFEVGPGLGALTRALLEAGAEVTAIEKDLRLRPVLEET   87 (271)
T ss_dssp             HHHHHHHHTTCCCSTTSSCCEECCHHHHHHHHHHHCCCCS-CEEEECCTTSHHHHHHHHTTCCEEEEESCGGGHHHHHHH
T ss_pred             HHHHHHHhcCCCccccCCccccCCHHHHHHHHHhcCCCCC-eEEEEeCchHHHHHHHHHcCCEEEEEECCHHHHHHHHHh
Confidence            3567889999999999999999999999999999998888 999999999999999999999999999999999999987


Q ss_pred             hcccCee
Q psy1134          92 YYFRNLC   98 (149)
Q Consensus        92 ~~~~~~~   98 (149)
                      +...++.
T Consensus        88 ~~~~~v~   94 (271)
T 3fut_A           88 LSGLPVR   94 (271)
T ss_dssp             TTTSSEE
T ss_pred             cCCCCEE
Confidence            6533343



>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>4f3n_A Uncharacterized ACR, COG1565 superfamily; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.75A {Burkholderia thailandensis} PDB: 4g67_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>1zkd_A DUF185; NESG, RPR58, structural genomics, PSI, protein structure INI northeast structural genomics consortium, unknown function; 2.10A {Rhodopseudomonas palustris} SCOP: c.66.1.52 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3iht_A S-adenosyl-L-methionine methyl transferase; YP_165822.1, STR genomics, joint center for structural genomics, JCSG; HET: MSE SAM; 1.80A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>2dpm_A M.dpnii 1, protein (adenine-specific methyltransferase dpnii 1); DNA adenine methyltransferase, methylase; HET: SAM; 1.80A {Streptococcus pneumoniae} SCOP: c.66.1.28 Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2g1p_A DNA adenine methylase; DAM methylation, GATC recognition, base flipping, bacterial factor, transferase-DNA complex; HET: DNA SAH; 1.89A {Escherichia coli} PDB: 2ore_D* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 149
d1zq9a1 278 c.66.1.24 (A:36-313) Probable dimethyladenosine tr 2e-20
d1zq9a1278 c.66.1.24 (A:36-313) Probable dimethyladenosine tr 2e-11
d1i4wa_ 322 c.66.1.24 (A:) Transcription factor sc-mtTFB {Bake 5e-16
d1qyra_ 252 c.66.1.24 (A:) High level kasugamycin resistance p 7e-16
d1yuba_ 245 c.66.1.24 (A:) rRNA adenine dimethylase {Streptoco 4e-15
d1qama_ 235 c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus 2e-13
d1xxla_ 234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 4e-07
d1vl5a_ 231 c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill 1e-06
d1u2za_406 c.66.1.31 (A:) Catalytic, N-terminal domain of his 2e-05
d1nw3a_328 c.66.1.31 (A:) Catalytic, N-terminal domain of his 3e-05
d2b25a1 324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 5e-05
d1l3ia_186 c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi 8e-05
d1g8sa_230 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Meth 8e-05
d1nkva_ 245 c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric 2e-04
d1yb2a1250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 2e-04
d1oria_ 316 c.66.1.6 (A:) Protein arginine N-methyltransferase 0.002
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Length = 278 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: rRNA adenine dimethylase-like
domain: Probable dimethyladenosine transferase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 82.7 bits (203), Expect = 2e-20
 Identities = 44/79 (55%), Positives = 55/79 (69%)

Query: 30  QHILKNPLIIQSIVDKGAIRPTDTVLEIGPGTGNMTVKILEQAKKVIACEIDPSCKSYFP 89
           QHILKNPLII SI+DK A+RPTD VLE+GPGTGNMTVK+LE+AKKV+ACE+DP   +   
Sbjct: 1   QHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELH 60

Query: 90  SLYYFRNLCLQEVPTDFDI 108
                  +  +      D+
Sbjct: 61  KRVQGTPVASKLQVLVGDV 79


>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 322 Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Length = 252 Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Length = 245 Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Length = 235 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Length = 328 Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 316 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
d1xxla_ 234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.65
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.64
d1wzna1 251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.64
d1vl5a_ 231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.62
d1y8ca_ 246 Putative methyltransferase CAC2371 {Clostridium ac 99.58
d1kpia_ 291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.58
d1xvaa_ 292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.58
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.58
d1nkva_ 245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.58
d2fk8a1 280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.57
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.54
d2p7ia1 225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.53
d2o57a1 282 Putative sarcosine dimethylglycine methyltransfera 99.52
d1yuba_ 245 rRNA adenine dimethylase {Streptococcus pneumoniae 99.49
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.48
d1kpga_ 285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.47
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.46
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.46
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.45
d1ri5a_ 252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.44
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.43
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.43
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.39
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.38
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.37
d1qama_ 235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 99.37
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.35
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.35
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 99.34
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.33
d2a14a1 257 Indolethylamine N-methyltransferase, INMT {Human ( 99.32
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.31
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.28
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.27
d1qyra_ 252 High level kasugamycin resistance protein KsgA {Es 99.26
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.19
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.19
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.19
d2g72a1 263 Phenylethanolamine N-methyltransferase, PNMTase {H 99.19
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 99.18
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.17
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 99.17
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.16
d1jqea_ 280 Histamine methyltransferase {Human (Homo sapiens) 99.15
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.15
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.13
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 99.08
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.08
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 99.03
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.03
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.0
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.0
d2b25a1 324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.0
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 98.99
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 98.96
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 98.92
d1i4wa_ 322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 98.92
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 98.9
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.89
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 98.88
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 98.87
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 98.78
d2ih2a1 223 DNA methylase TaqI, N-terminal domain {Thermus aqu 98.77
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.77
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.77
d2h00a1250 Methyltransferase 10 domain containing protein MET 98.74
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 98.72
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 98.69
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.68
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 98.68
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.65
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.56
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.52
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 98.5
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.47
d2f8la1 328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.33
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.3
d2okca1 425 Type I restriction enzyme StySJI M protein {Bacter 98.29
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 98.23
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 98.1
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 98.07
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 98.03
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 98.0
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 97.96
d1uira_ 312 Spermidine synthase {Thermus thermophilus [TaxId: 97.92
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 97.9
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 97.89
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 97.71
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 97.7
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 97.7
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 97.67
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 97.66
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 97.63
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 97.61
d1xj5a_ 290 Spermidine synthase {Thale cress (Arabidopsis thal 97.39
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 97.29
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 97.19
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.16
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.14
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.97
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 96.87
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 96.84
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 96.84
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 96.68
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 96.66
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 96.63
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.53
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.35
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 96.34
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.21
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 96.15
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 95.92
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.82
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 95.38
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 95.36
d1zkda1 365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 95.26
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 95.16
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.8
d2c7pa1 327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 94.69
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 94.54
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 94.46
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 94.28
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 94.0
d1dcta_ 324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 93.95
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 93.65
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 93.47
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 93.2
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 93.16
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 92.98
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 92.89
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 91.94
d1g55a_ 343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 91.87
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 91.87
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 91.76
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 91.3
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 91.19
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 90.55
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 90.37
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 89.87
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 89.81
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 89.63
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 89.5
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 88.8
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 88.66
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 88.62
d1mv8a2 202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 88.48
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 88.41
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 88.08
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 87.6
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 87.58
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 87.53
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 87.46
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 86.96
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 86.78
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 86.39
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 85.85
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 85.85
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 85.08
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 85.0
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 84.78
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 84.45
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 84.37
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 84.35
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 84.09
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 83.78
d1dhra_ 236 Dihydropteridin reductase (pteridine reductase) {R 83.75
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 83.59
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 83.49
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 83.43
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 83.28
d2dpma_ 275 DNA methylase DpnM {Streptococcus pneumoniae [TaxI 83.21
d2o23a1 248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 83.1
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 82.92
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 82.66
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 82.53
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 81.81
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 81.58
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 81.38
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 81.37
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 81.35
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 80.85
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 80.24
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 80.04
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: UbiE/COQ5-like
domain: Hypothetical protein YcgJ
species: Bacillus subtilis [TaxId: 1423]
Probab=99.65  E-value=1.3e-16  Score=114.94  Aligned_cols=86  Identities=17%  Similarity=0.219  Sum_probs=69.9

Q ss_pred             HHHHHHHHHHcCCCCCCeEEEEcCCcchhHHHHHhcCCeEEEEeCChhHHhhhhhhhcc---cCeeecc--------CCC
Q psy1134          36 PLIIQSIVDKGAIRPTDTVLEIGPGTGNMTVKILEQAKKVIACEIDPSCKSYFPSLYYF---RNLCLQE--------VPT  104 (149)
Q Consensus        36 ~~~~~~~~~~l~~~~~~~vLDiGcG~G~~~~~l~~~~~~v~giD~s~~~i~~a~~~~~~---~~~~~~~--------~~~  104 (149)
                      .+....+++..+++++.+|||||||+|.++..+++.+.+|+|+|+|+.|++.|+++...   .+.....        ..+
T Consensus         2 ~~~~~~l~~~~~~~~~~rILDiGcGtG~~~~~la~~~~~v~gvD~S~~~l~~A~~~~~~~~~~~~~~~~~d~~~~~~~~~   81 (234)
T d1xxla_           2 HHSLGLMIKTAECRAEHRVLDIGAGAGHTALAFSPYVQECIGVDATKEMVEVASSFAQEKGVENVRFQQGTAESLPFPDD   81 (234)
T ss_dssp             HHHHHHHHHHHTCCTTCEEEEESCTTSHHHHHHGGGSSEEEEEESCHHHHHHHHHHHHHHTCCSEEEEECBTTBCCSCTT
T ss_pred             chHHHHHHHHhCCCCCCEEEEeCCcCcHHHHHHHHhCCeEEEEeCChhhhhhhhhhhccccccccccccccccccccccc
Confidence            34567788999999999999999999999999999999999999999999999887532   2222211        236


Q ss_pred             CCcchhhHHHHhccccch
Q psy1134         105 DFDIKTLIDTVLNEINFA  122 (149)
Q Consensus       105 ~~d~v~~~~~~l~~~~~~  122 (149)
                      +||.|++. .++++++++
T Consensus        82 ~fD~v~~~-~~l~~~~d~   98 (234)
T d1xxla_          82 SFDIITCR-YAAHHFSDV   98 (234)
T ss_dssp             CEEEEEEE-SCGGGCSCH
T ss_pred             ccceeeee-ceeecccCH
Confidence            89999988 888888764



>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2dpma_ c.66.1.28 (A:) DNA methylase DpnM {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure