Diaphorina citri psyllid: psy11350

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-

MSDDEDVIYVKKQNTVHYGSLEEQERKRLAANKDVDDDQEKYTNVHTSNVYMEIDDEMAKDKQALLQEFERRKKARHVNVSTDDNQVKLNLRQLGEPICLFGEEYSLAKAKERLAKAKEHLHIPEATRTARNQELQKHLTSLSIYCSQVGDTRPISYCSFSPDSQHVATASWSGLCKLWTVPECELVQTFRGHDCNVGAIEFHPLPSEGAVCSLASCAQDGSVKLWSLDKDTPLANLEGHEPFRVSRIKFHPSGRFLGTCCWDHSWRLDTPLANLEGHEPFRVSRIKFHPSGRFLGTCCWDHSWRLWDLNQGQEVLHQEGHGKPVYCMSFQGDGSVVATGGLDAFGRVWDLRTGRCIMFLEGHLKSVFSVDFSPDGYHLATGSEDNAVKIWDLRKRRLLKWCTQLLPNSIGVTSLLTDLYIDVLESLNPGIGNIISSALKEQVEPIPLLLDIQKLTFKFDSDLHAMVLNQK

cccccEEEEEEcccEEEEEccHHHHHHHHHccccccccccCECccccccCEEEEcHHHHHHHHHHEEEEEEcccccEEEEEccccEEEEEEccccccCEECcccccccEEEEEEEccccEEEEccccccEEEccccccccccEEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEccccCEEEEEEcccccEEEEEEccccccccccEEEEEcccccEEEEEccccccEEEccccccccEEEEEEcccccEEEEcccccCEEEccccccccccccccEEEEEEcccccEEEEccccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEEccccccEEEEEccccEEEEEcccccccEEEEEEcccccEEEEccccccEEEEEccccEEEEEEEEEcccccEEEEEEccccEEEEcccccccccEEEccccccEEEEEEcccccEEEEEccccEEEEEEccc

*SDDEDVIYVKKQNTVHYGSLEEQE*******************VHTSNVYMEIDDEMAKDKQALLQEFERRKKARHVNVSTDDNQVKLNLRQLGEPICLFGEEYSLAKAKERLAKAKEHLHIPEATRTARNQELQKHLTSLSIYCSQVGDTRPISYCSFSPDSQHVATASWSGLCKLWTVPECELVQTFRGHDCNVGAIEFHPLPSEGAVCSLASCAQDGSVKLWSLDKDTPLANLEGHEPFRVSRIKFHPSGRFLGTCCWDHSWRLDTPLANLEGHEPFRVSRIKFHPSGRFLGTCCWDHSWRLWDLNQGQEVLHQEGHGKPVYCMSFQGDGSVVATGGLDAFGRVWDLRTGRCIMFLEGHLKSVFSVDFSPDGYHLATGSEDNAVKIWDLRKRRLLKWCTQLLPNSIGVTSLLTDLYIDVLESLNPGIGNIISSALKEQVEPIPLLLDIQKLTFKFDSDLHAMVLNQ*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSDDEDVIYVKKQNTVHYGSxxxxxxxxxxxxxxxxxxxxxYTNVHTSNVYMEIDDEMAKDKQALLQEFERRKKARHVNVSTDDNQVKLNLRQLGEPICLFGEEYSLAKAKERLAKAKEHLHIPEATRTARNQELQKHLTSLSIYCSQVGDTRPISYCSFSPDSQHVATASWSGLCKLWTVPECELVQTFRGHDCNVGAIEFHPLPSEGAVCSLASCAQDGSVKLWSLDKDTPLANLEGHEPFRVSRIKFHPSGRFLGTCCWDHSWRLDTPLANLEGHEPFRVSRIKFHPSGRFLGTCCWDHSWRLWDLNQGQEVLHQEGHGKPVYCMSFQGDGSVVATGGLDAFGRVWDLRTGRCIMFLEGHLKSVFSVDFSPDGYHLATGSEDNAVKIWDLRKRRLLKWCTQLLPNSIGVTSLLTDLYIDVLESLNPGIGNIISSALKEQVEPIPLLLDIQKLTFKFDSDLHAMVLNQK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
U4/U6 small nuclear ribonucleoprotein Prp4	Involved in pre-mRNA splicing.	confident	O43172
U4/U6 small nuclear ribonucleoprotein Prp4	Involved in pre-mRNA splicing.	confident	Q3MHE2
U4/U6 small nuclear ribonucleoprotein Prp4	Involved in pre-mRNA splicing.	confident	Q9DAW6

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0071001 [CC]	U4/U6 snRNP	probable	GO:0005575, GO:0032991, GO:0043231, GO:0030532, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0071011 [CC]	precatalytic spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]	catalytic step 2 spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0017070 [MF]	U6 snRNA binding	probable	GO:0097159, GO:0017069, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0009987 [BP]	cellular process	probable	GO:0008150
GO:0030621 [MF]	U4 snRNA binding	probable	GO:0097159, GO:0017069, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0015030 [CC]	Cajal body	probable	GO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SFZ, chain A
Confidence level:very confident
Coverage over the Query: 144-432,444-470
View the alignment between query and template
View the model in PyMOL

Template: 4AOW, chain A
Confidence level:very confident
Coverage over the Query: 125-395
View the alignment between query and template
View the model in PyMOL

Template: 2DK4, chain A
Confidence level:probable
Coverage over the Query: 79-107
View the alignment between query and template
View the model in PyMOL