Diaphorina citri psyllid: psy11354

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MSDDEDVIYVKKQNTVHYGSLEEQERKRLAANKDVDDDQEKYTNVHTSNVYMEIDDEMAKDKQALLQEFERRKKARHVNVSTDDNQVKLNLRQLGEPICLFGEGPAERRSRLRDLLSSLQ
cccccccccccccccEEEccHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccEEccccccHHHHHHHHHHHHcc
*******IYVKKQNTVHYG******************************************************KARHVNVSTDDNQVKLNLRQLGEPICLFGEGPAERRSRLRDLLS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDDEDVIYVKKQNTVHYGSxxxxxxxxxxxxxxxxxxxxxYTNVHTSNVYMEIDDEMAKDKQALLQEFERRKKARHVNVSTDDNQVKLNLRQLGEPICLFGEGPAERRSRLRDLLSSLQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
U4/U6 small nuclear ribonucleoprotein Prp4 Involved in pre-mRNA splicing.confidentO43172

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030621 [MF]U4 snRNA bindingprobableGO:0097159, GO:0017069, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0017070 [MF]U6 snRNA bindingprobableGO:0097159, GO:0017069, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1MZW, chain B
Confidence level:very confident
Coverage over the Query: 86-116
View the alignment between query and template
View the model in PyMOL