Diaphorina citri psyllid: psy11364

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MNFNYKRSTLHFLISVSDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSRDALRKHDK
ccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccHHHHHHccc
*******STLHFLISVSDHCL*****************************KLFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSR********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNFNYKRSTLHFLISVSDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSRDALRKHDK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003674 [MF]molecular_functionprobable
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CSH, chain A
Confidence level:confident
Coverage over the Query: 21-101
View the alignment between query and template
View the model in PyMOL