Psyllid ID: psy11364


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MNFNYKRSTLHFLISVSDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSRDALRKHDK
ccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccHHHHHHHcc
ccccEEcccHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEEccccccccccEEEEHHccccccEcccccHHHHHcHHHHHHccc
MNFNYKRSTLHFLISVsdhcltsplsssipgssktkasgsgttggssnhsKLFATCFVCgkqlsnqynLRVHMETHqnafyacsscshvsrsrdalrkhdk
MNFNYKRSTLHFLISVSDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQNAfyacsscshvsrsrdalrkhdk
MNFNYKRSTLHFLISVSDHCltsplsssipgssktkasgsgttggssnhskLFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSRDALRKHDK
*******STLHFLISVSDHCL*****************************KLFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSC***************
********************************************************FVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSR********
MNFNYKRSTLHFLISVSDHCLTS***********************SNHSKLFATCFVCGKQLSNQYNLRVHMETHQNAFYACSS****************
*NFNYKRSTLHFLISVSDHCLT***************************SKLFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSR********
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNFNYKRSTLHFLISVSDHCLTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSRDALRKHDK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query101 2.2.26 [Sep-21-2011]
Q91ZD1312 Protein odd-skipped-relat yes N/A 0.782 0.253 0.325 0.0007
Q8N2R0312 Protein odd-skipped-relat yes N/A 0.782 0.253 0.325 0.0008
>sp|Q91ZD1|OSR2_MOUSE Protein odd-skipped-related 2 OS=Mus musculus GN=Osr2 PE=1 SV=1 Back     alignment and function desciption
 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 35/80 (43%), Gaps = 1/80 (1%)

Query: 21  LTSPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQNA- 79
           L+  L S I G SK       + G   + +K    C  CG+  +  YNL +H  TH +  
Sbjct: 139 LSPGLGSPISGLSKLNPDRKPSRGRLPSKTKKEFICKFCGRHFTKSYNLLIHERTHTDER 198

Query: 80  FYACSSCSHVSRSRDALRKH 99
            Y C  C    R +D LR H
Sbjct: 199 PYTCDICHKAFRRQDHLRDH 218





Mus musculus (taxid: 10090)
>sp|Q8N2R0|OSR2_HUMAN Protein odd-skipped-related 2 OS=Homo sapiens GN=OSR2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query101
193591953 324 PREDICTED: zinc finger protein 131-like 0.762 0.237 0.597 7e-19
195377894 628 GJ13592 [Drosophila virilis] gi|19415488 0.623 0.100 0.682 1e-18
195020144 638 GH14679 [Drosophila grimshawi] gi|193898 0.574 0.090 0.724 2e-18
195129063 650 GI13789 [Drosophila mojavensis] gi|19392 0.574 0.089 0.724 2e-18
194752385 653 GF10955 [Drosophila ananassae] gi|190625 0.495 0.076 0.82 2e-18
170054867 666 conserved hypothetical protein [Culex qu 0.495 0.075 0.8 2e-18
195590068 624 GD12665 [Drosophila simulans] gi|1941967 0.504 0.081 0.803 2e-18
307186839 341 Protein bric-a-brac 2 [Camponotus florid 0.603 0.178 0.730 2e-18
157130500 672 hypothetical protein AaeL_AAEL011779 [Ae 0.495 0.074 0.8 3e-18
195494110 650 GE20067 [Drosophila yakuba] gi|194180799 0.663 0.103 0.647 3e-18
>gi|193591953|ref|XP_001946753.1| PREDICTED: zinc finger protein 131-like isoform 1 [Acyrthosiphon pisum] gi|328715555|ref|XP_003245660.1| PREDICTED: zinc finger protein 131-like isoform 2 [Acyrthosiphon pisum] gi|328715558|ref|XP_003245661.1| PREDICTED: zinc finger protein 131-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 97.8 bits (242), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 46/77 (59%), Positives = 53/77 (68%)

Query: 23  SPLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQNAFYA 82
           +P  + +      + S S      +  SKL+  CF+CGKQLSN YNLRVHMETHQNA YA
Sbjct: 215 APTPTDLVQGPVVQGSQSDNIKSRTPVSKLYTMCFICGKQLSNHYNLRVHMETHQNAQYA 274

Query: 83  CSSCSHVSRSRDALRKH 99
           CS CSHVSRSRDALRKH
Sbjct: 275 CSVCSHVSRSRDALRKH 291




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195377894|ref|XP_002047722.1| GJ13592 [Drosophila virilis] gi|194154880|gb|EDW70064.1| GJ13592 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195020144|ref|XP_001985131.1| GH14679 [Drosophila grimshawi] gi|193898613|gb|EDV97479.1| GH14679 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195129063|ref|XP_002008978.1| GI13789 [Drosophila mojavensis] gi|193920587|gb|EDW19454.1| GI13789 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|194752385|ref|XP_001958503.1| GF10955 [Drosophila ananassae] gi|190625785|gb|EDV41309.1| GF10955 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|170054867|ref|XP_001863324.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167875011|gb|EDS38394.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195590068|ref|XP_002084769.1| GD12665 [Drosophila simulans] gi|194196778|gb|EDX10354.1| GD12665 [Drosophila simulans] Back     alignment and taxonomy information
>gi|307186839|gb|EFN72256.1| Protein bric-a-brac 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|157130500|ref|XP_001661900.1| hypothetical protein AaeL_AAEL011779 [Aedes aegypti] gi|108871884|gb|EAT36109.1| AAEL011779-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|195494110|ref|XP_002094698.1| GE20067 [Drosophila yakuba] gi|194180799|gb|EDW94410.1| GE20067 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query101
FB|FBgn0052121 648 CG32121 [Drosophila melanogast 0.475 0.074 0.812 1.8e-17
UNIPROTKB|F1MYX1598 ZNF782 "Uncharacterized protei 0.455 0.076 0.382 0.00011
UNIPROTKB|K7EQ32222 ZNF223 "Zinc finger protein 22 0.455 0.207 0.361 0.00014
UNIPROTKB|G3MYG2666 ZNF782 "Uncharacterized protei 0.455 0.069 0.382 0.00014
ZFIN|ZDB-GENE-080212-4363 zgc:174311 "zgc:174311" [Danio 0.455 0.126 0.347 0.00016
ZFIN|ZDB-GENE-050208-384286 si:dkey-1b17.6 "si:dkey-1b17.6 0.465 0.164 0.375 0.00018
UNIPROTKB|Q3KNW1292 SNAI3 "Zinc finger protein SNA 0.445 0.154 0.434 0.00019
FB|FBgn0030240 889 CG2202 [Drosophila melanogaste 0.465 0.052 0.404 0.0002
ZFIN|ZDB-GENE-060503-255361 si:dkey-262g12.3 "si:dkey-262g 0.445 0.124 0.413 0.00021
FB|FBgn002424481 drm "drumstick" [Drosophila me 0.435 0.543 0.347 0.00021
FB|FBgn0052121 CG32121 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 223 (83.6 bits), Expect = 1.8e-17, P = 1.8e-17
 Identities = 39/48 (81%), Positives = 44/48 (91%)

Query:    52 LFATCFVCGKQLSNQYNLRVHMETHQNAFYACSSCSHVSRSRDALRKH 99
             L+ATCF+C KQLSNQYNLRVH+ETHQN  YAC+ CSHVSRS+DALRKH
Sbjct:   470 LYATCFICHKQLSNQYNLRVHLETHQNVRYACNVCSHVSRSKDALRKH 517




GO:0005622 "intracellular" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|F1MYX1 ZNF782 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|K7EQ32 ZNF223 "Zinc finger protein 223" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3MYG2 ZNF782 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080212-4 zgc:174311 "zgc:174311" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-384 si:dkey-1b17.6 "si:dkey-1b17.6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q3KNW1 SNAI3 "Zinc finger protein SNAI3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0030240 CG2202 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-255 si:dkey-262g12.3 "si:dkey-262g12.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0024244 drm "drumstick" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 101
KOG2462|consensus279 99.82
KOG2462|consensus279 99.68
KOG3623|consensus1007 99.55
KOG3576|consensus267 99.46
KOG3623|consensus 1007 99.36
PHA0276855 hypothetical protein; Provisional 99.24
PHA00733128 hypothetical protein 99.09
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.95
KOG1074|consensus 958 98.95
KOG3576|consensus267 98.91
KOG1074|consensus 958 98.85
KOG3608|consensus 467 98.59
PHA0073279 hypothetical protein 98.51
PHA0061644 hypothetical protein 98.46
KOG3608|consensus 467 98.41
KOG3993|consensus 500 98.32
PHA0276855 hypothetical protein; Provisional 98.22
PLN03086567 PRLI-interacting factor K; Provisional 98.15
PHA00733128 hypothetical protein 98.05
PLN03086567 PRLI-interacting factor K; Provisional 98.0
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.0
COG5189423 SFP1 Putative transcriptional repressor regulating 97.92
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.86
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.84
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.72
PHA0061644 hypothetical protein 97.68
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.48
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.44
PRK04860160 hypothetical protein; Provisional 97.41
PHA0073279 hypothetical protein 97.29
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.27
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.25
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.18
smart0035526 ZnF_C2H2 zinc finger. 97.08
smart0035526 ZnF_C2H2 zinc finger. 96.91
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.85
KOG3993|consensus 500 96.77
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.69
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.59
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.02
KOG1146|consensus 1406 95.83
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.34
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 95.05
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 94.98
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.52
KOG2186|consensus 276 93.06
KOG2893|consensus 341 93.03
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 90.94
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 90.8
COG5189423 SFP1 Putative transcriptional repressor regulating 90.52
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 89.78
COG5048467 FOG: Zn-finger [General function prediction only] 89.58
PRK00464154 nrdR transcriptional regulator NrdR; Validated 89.45
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 88.69
COG404965 Uncharacterized protein containing archaeal-type C 86.2
PRK04860160 hypothetical protein; Provisional 85.41
PHA0062659 hypothetical protein 85.38
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 85.17
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 83.35
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 80.95
PRK06266178 transcription initiation factor E subunit alpha; V 80.89
PF1371937 zinc_ribbon_5: zinc-ribbon domain 80.15
>KOG2462|consensus Back     alignment and domain information
Probab=99.82  E-value=4.6e-21  Score=121.90  Aligned_cols=76  Identities=25%  Similarity=0.394  Sum_probs=73.6

Q ss_pred             CCCCCCCCCCCccCCCCCCCCCCCCCCCcceecccchhhcCCHHHHHHHHHhhCC-CCcccccCccccCChHHHhccc
Q psy11364         24 PLSSSIPGSSKTKASGSGTTGGSSNHSKLFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHVSRSRDALRKHD  100 (101)
Q Consensus        24 ~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~h~~-kp~~C~~C~k~f~~~~~l~~H~  100 (101)
                      +++|.+||+.|..+.-|+.|.+.+. +|+||.|..|+++|..+++|+.||++|.+ |+|.|..|+|.|...+.|.+|.
T Consensus       187 ~c~C~iCGKaFSRPWLLQGHiRTHT-GEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~  263 (279)
T KOG2462|consen  187 PCECGICGKAFSRPWLLQGHIRTHT-GEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHS  263 (279)
T ss_pred             CcccccccccccchHHhhccccccc-CCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhh
Confidence            8999999999999999999999988 69999999999999999999999999999 9999999999999999999985



>KOG2462|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 9e-05
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
 Score = 36.6 bits (85), Expect = 9e-05
 Identities = 10/49 (20%), Positives = 16/49 (32%), Gaps = 4/49 (8%)

Query: 55 TCFVCGKQLSNQYNLRVHMETHQNAF----YACSSCSHVSRSRDALRKH 99
           C +CG     + +L  H   H        + C  C       D++  H
Sbjct: 9  QCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAH 57


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query101
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.77
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.73
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.71
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.68
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.66
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.66
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.64
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.64
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.63
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.62
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.62
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.6
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.58
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.58
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.57
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.56
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.55
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.55
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.55
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.54
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.54
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.53
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.53
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.53
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.53
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.53
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.52
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.52
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.51
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.51
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.51
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.5
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.5
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.5
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.49
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.48
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.48
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.48
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.47
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.47
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.47
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.46
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.45
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.45
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.44
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.44
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.4
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.39
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.38
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.38
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.37
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.35
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.34
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.33
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.32
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.32
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.3
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.29
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.29
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.28
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.27
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.26
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.26
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.26
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.25
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.25
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.25
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.25
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.24
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.24
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.24
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.24
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.23
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.23
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.23
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.23
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.22
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.22
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.22
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.22
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.21
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.21
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.21
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.21
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.21
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.21
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.19
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.15
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.13
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.12
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.12
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.04
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.03
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.03
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.03
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.03
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.02
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.02
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.02
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.01
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.0
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.99
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.99
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.99
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.97
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.97
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.95
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.94
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.93
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.91
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.9
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.89
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.87
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.85
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.83
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.82
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.82
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.73
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.73
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.73
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.65
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.64
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.64
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.63
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.63
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.63
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.63
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.62
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.62
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.61
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.61
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.61
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.6
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.6
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.6
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.6
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.6
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.6
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.59
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.59
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.59
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.59
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.59
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.59
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.59
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.59
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.59
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.59
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.59
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.58
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.58
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.58
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.58
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.58
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.58
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.58
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.58
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.57
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.57
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.57
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.56
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.56
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.56
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.56
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.56
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.56
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.56
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.56
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.56
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.56
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.56
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.55
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.55
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.55
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.55
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.55
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.55
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.55
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.55
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.55
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.55
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.55
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.54
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.54
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.54
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.54
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.54
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.54
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.54
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.54
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.54
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.53
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.53
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.53
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.53
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.53
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.53
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.53
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.53
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.53
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.53
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.53
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.52
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.52
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.52
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.52
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.51
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.51
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.51
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.51
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.5
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.49
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.49
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.49
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.49
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.48
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.48
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.48
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.48
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.47
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.47
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.46
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.46
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.46
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.45
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.44
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.43
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.43
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.41
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.4
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.4
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.4
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.39
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.38
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.37
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.36
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.36
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.35
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.35
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.35
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.34
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.33
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.33
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.33
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.33
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.31
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.31
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.65
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.31
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.29
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.28
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.28
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.27
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.26
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.26
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.25
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.56
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.24
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.24
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.22
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.22
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.22
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.52
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.2
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.51
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.2
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.19
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.17
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.14
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.13
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.42
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.12
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.11
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.1
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.1
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.09
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.08
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.08
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.07
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.07
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.06
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.3
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.03
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.02
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.97
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.95
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 97.92
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.89
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.88
1vd4_A62 Transcription initiation factor IIE, alpha subunit 97.79
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 97.76
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.45
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.42
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 96.5
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.46
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.45
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.5
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.5
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 93.18
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 91.85
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 86.9
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 81.1
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 80.39
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
Probab=99.77  E-value=1.8e-19  Score=92.01  Aligned_cols=51  Identities=24%  Similarity=0.436  Sum_probs=49.5

Q ss_pred             CcceecccchhhcCCHHHHHHHHHhhCC-CCcccccCccccCChHHHhcccC
Q psy11364         51 KLFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHVSRSRDALRKHDK  101 (101)
Q Consensus        51 ~~~~~C~~c~~~~~~~~~l~~h~~~h~~-kp~~C~~C~k~f~~~~~l~~H~~  101 (101)
                      |+||.|..|++.|.....|..|+++|++ +||.|.+||++|...++|..|++
T Consensus         2 EKpy~C~~C~k~F~~~~~L~~H~~~Ht~ekp~~C~~C~k~F~~~~~L~~H~~   53 (60)
T 4gzn_C            2 ERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSEVNRHLK   53 (60)
T ss_dssp             CCCEECTTTCCEESSHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHGG
T ss_pred             CCCccCCCCCCEeCCHHHHHHHHHHhCCCcCeECCCCCCCcCCHHHHHHHhC
Confidence            7899999999999999999999999999 99999999999999999999975



>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query101
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.74
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.24
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.22
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.2
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.16
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.15
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.12
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.1
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.09
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.07
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.06
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.06
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.04
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.04
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.03
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.02
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.99
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.97
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.93
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.9
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.83
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.8
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.78
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.74
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.71
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.65
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.63
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.58
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.55
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.55
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.54
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.49
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.47
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.46
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.45
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.42
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.42
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.42
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.35
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.32
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.28
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.22
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.2
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.17
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.11
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.88
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.86
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.67
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.66
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.6
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.53
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.43
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.39
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.37
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.34
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.34
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.3
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.3
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 97.27
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.26
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.19
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.16
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.1
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.05
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.0
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.91
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.89
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.6
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.57
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.57
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.53
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.49
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.49
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.47
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.46
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.38
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.32
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.29
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.26
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.16
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.0
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.96
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.88
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.58
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 95.38
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.14
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.11
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.97
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.55
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.28
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.23
d1y0jb136 U-shaped transcription factor, different fingers { 92.72
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 91.45
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 91.16
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 90.03
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.02
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 88.09
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 87.97
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 86.34
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 86.13
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 84.47
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 83.36
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 81.42
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 81.39
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 81.04
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.74  E-value=6.5e-19  Score=86.64  Aligned_cols=50  Identities=26%  Similarity=0.524  Sum_probs=47.9

Q ss_pred             CcceecccchhhcCCHHHHHHHHHhhCC-CCcccccCccccCChHHHhcccC
Q psy11364         51 KLFATCFVCGKQLSNQYNLRVHMETHQN-AFYACSSCSHVSRSRDALRKHDK  101 (101)
Q Consensus        51 ~~~~~C~~c~~~~~~~~~l~~h~~~h~~-kp~~C~~C~k~f~~~~~l~~H~~  101 (101)
                      ++||.| .||+.|.....|..|+++|++ +||.|.+||++|...+.|..|++
T Consensus         1 EK~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r   51 (53)
T d2csha1           1 DKLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMK   51 (53)
T ss_dssp             CCCEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHT
T ss_pred             CcCCCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHh
Confidence            579999 599999999999999999999 99999999999999999999985



>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure