Diaphorina citri psyllid: psy11365


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
MSYDGPVHNHGLCHVDSVRRCPTMALFITTACVMSTLILLVTSSRRPEHWIVPGGGVEPEEEPAATALREVAEEAGVLGKLGRSLGVFEVRPKVP
cccccccccccccccccccccccccEEEEEEEEEccEEEEEECccccccEEEccccccccccHHHHHHHHHHHHHccEEEEcEEEEEEEcccccc
*********HGLCHVDSVRRCPTMALFITTACVMSTLILLVTSSRRPEHWIVPGGGVEPEEEPAATALREVAEEAGVLGKLGRSLGVFEVRP***
xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYDGPVHNHGLCHVDSVRRCPTMALFITTACVMSTLILLVTSSRRPEHWIVPGGGVEPEEEPAATALREVAEEAGVLGKLGRSLGVFEVRPKVP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Diphosphoinositol polyphosphate phosphohydrolase 2 Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), PP-InsP4 and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphate Ap6A, but not Ap5A. The major reaction products are ADP and p4a from Ap6A. Also able to hydrolyze 5-phosphoribose 1-diphosphate.confidentQ5RAF0
Diphosphoinositol polyphosphate phosphohydrolase 2 Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), PP-InsP4 and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphate Ap6A, but not Ap5A. The major reaction products are ADP and p4a from Ap6A. Also able to hydrolyze 5-phosphoribose 1-diphosphate.confidentQ9NZJ9
Diphosphoinositol polyphosphate phosphohydrolase 2 Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), PP-InsP4 and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphate Ap6A, but not Ap5A. The major reaction products are ADP and p4a from Ap6A. Also able to hydrolyze 5-phosphoribose 1-diphosphate.confidentQ8R2U6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050072 [MF]m7G(5')pppN diphosphatase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674
GO:0009117 [BP]nucleotide metabolic processprobableGO:0006139, GO:0044710, GO:0044238, GO:1901360, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0071704, GO:0006796, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0006793, GO:0019637, GO:0006753, GO:0055086, GO:0046483
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008486 [MF]diphosphoinositol-polyphosphate diphosphatase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674
GO:0043647 [BP]inositol phosphate metabolic processprobableGO:0044710, GO:0009987, GO:0019751, GO:0044237, GO:0006066, GO:0071704, GO:0006796, GO:0008150, GO:0044281, GO:0008152, GO:0006793, GO:0019637, GO:1901615

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FVV, chain A
Confidence level:very confident
Coverage over the Query: 35-92
View the alignment between query and template
View the model in PyMOL
Template: 1VK6, chain A
Confidence level:confident
Coverage over the Query: 15-90
View the alignment between query and template
View the model in PyMOL