Diaphorina citri psyllid: psy11388


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MLFNTQCERAFKILREHGSLILSLFAMMISTGLPELSSEKDVNYLRETLVLDLTEEDAIKHFRSKFGEALANSWKTSLNWASHNLAKNNK
ccHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccc
MLFNTQCERAFKILREHGSLILSLFAMMISTGLPELSSEKDVNYLRETLVLDLTEEDAIKHFRSKFGEALANSWKTSLNWASHNLAKN**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLFNTQCERAFKILREHGSLILSLFAMMISTGLPELSSEKDVNYLRETLVLDLTEEDAIKHFRSKFGEALANSWKTSLNWASHNLAKNNK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform Phosphoinositide-3-kinase (PI3K) that phosphorylates PftdIns(4,5)P2 (Phosphatidylinositol 4,5-bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Mediates immune responses. Plays a role in B-cell development, proliferation, migration, and function. Required for B-cell receptor (BCR) signaling. Mediates B-cell proliferation response to anti-IgM, anti-CD40 and IL4 stimulation. Promotes cytokine production in response to TLR4 and TLR9. Required for antibody class switch mediated by TLR9. Involved in the antigen presentation function of B-cells. Involved in B-cell chemotaxis in response to CXCL13 and sphingosine 1-phosphate (S1P). Required for proliferation, signaling and cytokine production of naive, effector and memory T-cells. Required for T-cell receptor (TCR) signaling. Mediates TCR signaling events at the immune synapse. Activation by TCR leads to antigen-dependent memory T-cell migration and retention to antigenic tissues. Together with PIK3CG participates in T-cell development. Contributes to T-helper cell expansion and differentiation. Required for T-cell migration mediated by homing receptors SELL/CD62L, CCR7 and S1PR1 and antigen dependent recruitment of T-cells. Together with PIK3CG is involved in natural killer (NK) cell development and migration towards the sites of inflammation. Participates in NK cell receptor activation. Have a role in NK cell maturation and cytokine production. Together with PIK3CG is involved in neutrophil chemotaxis and extravasation. Together with PIK3CG participates in neutrophil respiratory burst. Have important roles in mast-cell development and mast cell mediated allergic response. Involved in stem cell factor (SCF)-mediated proliferation, adhesion and migration. Required for allergen-IgE-induced degranulation and cytokine release. The lipid kinase activity is required for its biological function.confidentO00329

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048813 [BP]dendrite morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0048169 [BP]regulation of long-term neuronal synaptic plasticityprobableGO:0010646, GO:0044057, GO:0031644, GO:0050804, GO:0050789, GO:0048167, GO:0065007, GO:0051239, GO:0023051, GO:0008150, GO:0051969, GO:0065008, GO:0048168, GO:0050794
GO:0001727 [MF]lipid kinase activityprobableGO:0016772, GO:0016740, GO:0016301, GO:0003674, GO:0003824
GO:0060074 [BP]synapse maturationprobableGO:0032502, GO:0050808, GO:0044707, GO:0007399, GO:0008150, GO:0009987, GO:0016043, GO:0044767, GO:0032501, GO:0044763, GO:0071840, GO:0048731, GO:0010259, GO:0007275, GO:0044699, GO:0048856
GO:0007390 [BP]germ-band shorteningprobableGO:0048598, GO:0032502, GO:0001700, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0036092 [BP]phosphatidylinositol-3-phosphate biosynthetic processprobableGO:0006650, GO:0044249, GO:0044255, GO:0045017, GO:0044710, GO:0008150, GO:0071704, GO:0006661, GO:0006644, GO:0006629, GO:1901576, GO:0009987, GO:0009058, GO:0046488, GO:0008152, GO:0046486, GO:0090407, GO:0008610, GO:0044238, GO:0008654, GO:0044237, GO:0006796, GO:0006793, GO:0019637, GO:0046474
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0046854 [BP]phosphatidylinositol phosphorylationprobableGO:0044238, GO:0006644, GO:0006650, GO:0071704, GO:0016310, GO:0009987, GO:0044710, GO:0044237, GO:0046834, GO:0006796, GO:0046488, GO:0008152, GO:0006793, GO:0019637, GO:0008150, GO:0046486, GO:0030258, GO:0044255, GO:0006629
GO:2000377 [BP]regulation of reactive oxygen species metabolic processprobableGO:0019222, GO:0031323, GO:0050794, GO:0008150, GO:0065007, GO:0050789
GO:0051124 [BP]synaptic growth at neuromuscular junctionprobableGO:0050808, GO:0048589, GO:0030154, GO:0048468, GO:0014706, GO:0022607, GO:0051146, GO:0061061, GO:0007275, GO:0044699, GO:0007517, GO:0040007, GO:0048869, GO:0071840, GO:0007519, GO:0016043, GO:0048513, GO:0007416, GO:0032502, GO:0055001, GO:0055002, GO:0032501, GO:0048741, GO:0009987, GO:0009888, GO:0048747, GO:0044767, GO:0044763, GO:0048731, GO:0007528, GO:0044707, GO:0007399, GO:0048856, GO:0044085, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0006979 [BP]response to oxidative stressprobableGO:0006950, GO:0008150, GO:0050896
GO:0030536 [BP]larval feeding behaviorprobableGO:0007631, GO:0030537, GO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0044699
GO:0007166 [BP]cell surface receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0007436 [BP]larval salivary gland morphogenesisprobableGO:0032502, GO:0044767, GO:0035272, GO:0009886, GO:0044707, GO:0007431, GO:0048513, GO:0032501, GO:0048856, GO:0009791, GO:0002165, GO:0002164, GO:0008150, GO:0007435, GO:0048731, GO:0022612, GO:0048732, GO:0009653, GO:0007275, GO:0044699, GO:0002168
GO:0006914 [BP]autophagyprobableGO:0009987, GO:0044237, GO:0044248, GO:0008150, GO:0008152, GO:0009056
GO:0005942 [CC]phosphatidylinositol 3-kinase complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424
GO:0031090 [CC]organelle membraneprobableGO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0045572 [BP]positive regulation of imaginal disc growthprobableGO:0048639, GO:0048638, GO:0045927, GO:0051094, GO:0046620, GO:0046622, GO:0040008, GO:0050789, GO:0050793, GO:0065007, GO:2000026, GO:0008150, GO:0051239, GO:0048518, GO:0045570, GO:0051240
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0055115 [BP]entry into diapauseprobableGO:0044767, GO:0032502, GO:0022611, GO:0008150, GO:0044699
GO:0045793 [BP]positive regulation of cell sizeprobableGO:0071840, GO:0009987, GO:0016043, GO:0090066, GO:0008361, GO:0065007, GO:0044763, GO:0044699, GO:0008150, GO:0065008, GO:0032535
GO:0016303 [MF]1-phosphatidylinositol-3-kinase activityprobableGO:0003824, GO:0052742, GO:0016772, GO:0016301, GO:0016773, GO:0016740, GO:0003674, GO:0035004
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0050773 [BP]regulation of dendrite developmentprobableGO:0010975, GO:0030154, GO:0051128, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0007275, GO:0048731
GO:0051823 [BP]regulation of synapse structural plasticityprobableGO:0019226, GO:0035637, GO:0050803, GO:0050807, GO:0051128, GO:0023052, GO:0050789, GO:0044699, GO:0065007, GO:0065008, GO:0032501, GO:0050877, GO:0009987, GO:0050794, GO:0044763, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:0008150
GO:0042113 [BP]B cell activationprobableGO:0009987, GO:0002376, GO:0045321, GO:0001775, GO:0046649, GO:0044763, GO:0008150, GO:0044699
GO:0048477 [BP]oogenesisprobableGO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0007292, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0007276, GO:0000003
GO:0007552 [BP]metamorphosisprobableGO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0045727 [BP]positive regulation of translationprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010608, GO:0009891, GO:2000112, GO:0051247, GO:0051246, GO:0032270, GO:0048518, GO:0065007, GO:0010468, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0032268, GO:0010557, GO:0010556, GO:0006417, GO:0048522
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0016049 [BP]cell growthprobableGO:0008150, GO:0009987, GO:0044763, GO:0040007, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WXF, chain A
Confidence level:very confident
Coverage over the Query: 2-74
View the alignment between query and template
View the model in PyMOL