Psyllid ID: psy11388

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MLFNTQCERAFKILREHGSLILSLFAMMISTGLPELSSEKDVNYLRETLVLDLTEEDAIKHFRSKFGEALANSWKTSLNWASHNLAKNNK
ccHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccc
cHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccEHHHHHHHHHccccc
MLFNTQCERAFKILREHGSLILSLFAMMIStglpelssekdvNYLRETLVLDLTEEDAIKHFRSKFGEALANSWKTSLNWASHNLAKNNK
MLFNTQCERAFKILREHGSLILSLFAMMISTGLpelssekdvNYLRETLVLDLTEEDAIKHFRSKFGEALANSWktslnwashnlaknnk
MLFNTQCERAFKILREHGSLILSLFAMMISTGLPELSSEKDVNYLRETLVLDLTEEDAIKHFRSKFGEALANSWKTSLNWASHNLAKNNK
****TQCERAFKILREHGSLILSLFAMMISTGLPELSSEKDVNYLRETLVLDLTEEDAIKHFRSKFGEALANSWKTSLNWA*********
MLFNTQCERAFKILREHGSLILSLFAMMISTGLPELSSEKDVNYLRETLVLDLTEEDAIKHFRSKFGEALANSWKTSLNWASHNLAKN**
MLFNTQCERAFKILREHGSLILSLFAMMISTGLPELSSEKDVNYLRETLVLDLTEEDAIKHFRSKFGEALANSWKTSLNWASHNLAKNNK
MLFNTQCERAFKILREHGSLILSLFAMMISTGLPELSSEKDVNYLRETLVLDLTEEDAIKHFRSKFGEALANSWKTSLNWASHNLAK***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLFNTQCERAFKILREHGSLILSLFAMMISTGLPELSSEKDVNYLRETLVLDLTEEDAIKHFRSKFGEALANSWKTSLNWASHNLAKNNK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query90 2.2.26 [Sep-21-2011]
O003291044 Phosphatidylinositol 4,5- yes N/A 0.977 0.084 0.579 1e-25
O359041043 Phosphatidylinositol 4,5- no N/A 0.977 0.084 0.579 1e-25
Q9Z1L01070 Phosphatidylinositol 4,5- no N/A 0.977 0.082 0.488 2e-21
Q8BTI91064 Phosphatidylinositol 4,5- no N/A 0.977 0.082 0.488 2e-21
P423381070 Phosphatidylinositol 4,5- no N/A 0.977 0.082 0.488 2e-21
P328711068 Phosphatidylinositol 4,5- no N/A 0.955 0.080 0.360 4e-15
P423371068 Phosphatidylinositol 4,5- no N/A 0.955 0.080 0.360 4e-15
P423361068 Phosphatidylinositol 4,5- no N/A 0.955 0.080 0.360 4e-15
Q9JHG71102 Phosphatidylinositol 4,5- no N/A 0.9 0.073 0.382 9e-13
O026971102 Phosphatidylinositol 4,5- no N/A 0.9 0.073 0.370 2e-12
>sp|O00329|PK3CD_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Homo sapiens GN=PIK3CD PE=1 SV=2 Back     alignment and function desciption
 Score =  114 bits (286), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 51/88 (57%), Positives = 66/88 (75%)

Query: 3    FNTQCERAFKILREHGSLILSLFAMMISTGLPELSSEKDVNYLRETLVLDLTEEDAIKHF 62
            F   CERA+ ILR HG L L LFA+M + GLPELS  KD+ YL+++L L  TEE+A+KHF
Sbjct: 956  FRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHF 1015

Query: 63   RSKFGEALANSWKTSLNWASHNLAKNNK 90
            R KF EAL  SWKT +NW +HN++K+N+
Sbjct: 1016 RVKFNEALRESWKTKVNWLAHNVSKDNR 1043
Phosphoinositide-3-kinase (PI3K) that phosphorylates PftdIns(4,5)P2 (Phosphatidylinositol 4,5-bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Mediates immune responses. Plays a role in B-cell development, proliferation, migration, and function. Required for B-cell receptor (BCR) signaling. Mediates B-cell proliferation response to anti-IgM, anti-CD40 and IL4 stimulation. Promotes cytokine production in response to TLR4 and TLR9. Required for antibody class switch mediated by TLR9. Involved in the antigen presentation function of B-cells. Involved in B-cell chemotaxis in response to CXCL13 and sphingosine 1-phosphate (S1P). Required for proliferation, signaling and cytokine production of naive, effector and memory T-cells. Required for T-cell receptor (TCR) signaling. Mediates TCR signaling events at the immune synapse. Activation by TCR leads to antigen-dependent memory T-cell migration and retention to antigenic tissues. Together with PIK3CG participates in T-cell development. Contributes to T-helper cell expansion and differentiation. Required for T-cell migration mediated by homing receptors SELL/CD62L, CCR7 and S1PR1 and antigen dependent recruitment of T-cells. Together with PIK3CG is involved in natural killer (NK) cell development and migration towards the sites of inflammation. Participates in NK cell receptor activation. Have a role in NK cell maturation and cytokine production. Together with PIK3CG is involved in neutrophil chemotaxis and extravasation. Together with PIK3CG participates in neutrophil respiratory burst. Have important roles in mast-cell development and mast cell mediated allergic response. Involved in stem cell factor (SCF)-mediated proliferation, adhesion and migration. Required for allergen-IgE-induced degranulation and cytokine release. The lipid kinase activity is required for its biological function.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 1EC: 5EC: 3
>sp|O35904|PK3CD_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Mus musculus GN=Pik3cd PE=1 SV=2 Back     alignment and function description
>sp|Q9Z1L0|PK3CB_RAT Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Rattus norvegicus GN=Pik3cb PE=2 SV=1 Back     alignment and function description
>sp|Q8BTI9|PK3CB_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Mus musculus GN=Pik3cb PE=1 SV=2 Back     alignment and function description
>sp|P42338|PK3CB_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Homo sapiens GN=PIK3CB PE=1 SV=1 Back     alignment and function description
>sp|P32871|PK3CA_BOVIN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Bos taurus GN=PIK3CA PE=1 SV=1 Back     alignment and function description
>sp|P42337|PK3CA_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Mus musculus GN=Pik3ca PE=1 SV=2 Back     alignment and function description
>sp|P42336|PK3CA_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Homo sapiens GN=PIK3CA PE=1 SV=2 Back     alignment and function description
>sp|Q9JHG7|PK3CG_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Mus musculus GN=Pik3cg PE=1 SV=2 Back     alignment and function description
>sp|O02697|PK3CG_PIG Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Sus scrofa GN=PIK3CG PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query90
242008483 1069 Phosphatidylinositol-4,5-bisphosphate 3- 0.988 0.083 0.842 2e-36
195391029 1076 GJ24290 [Drosophila virilis] gi|19415225 0.977 0.081 0.829 2e-35
328720441 1067 PREDICTED: phosphatidylinositol-4,5-bisp 0.988 0.083 0.820 2e-35
195055105 1084 GH16124 [Drosophila grimshawi] gi|193892 0.977 0.081 0.818 7e-35
195113045 1076 GI22170 [Drosophila mojavensis] gi|19391 0.977 0.081 0.818 9e-35
157132832 1055 phosphatidylinositol 3-kinase catalytic 0.977 0.083 0.829 1e-34
194899718 1086 GG15290 [Drosophila erecta] gi|190651108 0.977 0.081 0.806 2e-34
195498258 1088 GE25053 [Drosophila yakuba] gi|194182547 0.977 0.080 0.806 2e-34
195449691 1113 GK22711 [Drosophila willistoni] gi|19416 0.977 0.079 0.806 2e-34
307196204 1070 Phosphatidylinositol-4,5-bisphosphate 3- 0.977 0.082 0.784 2e-34
>gi|242008483|ref|XP_002425033.1| Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform, putative [Pediculus humanus corporis] gi|212508682|gb|EEB12295.1| Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 81/89 (91%)

Query: 2    LFNTQCERAFKILREHGSLILSLFAMMISTGLPELSSEKDVNYLRETLVLDLTEEDAIKH 61
            +F   CE+AF ILR HGSLILSLFAMMISTGLPELSSEKD+NYLRETLVLDL+E +A+ H
Sbjct: 980  IFQNHCEKAFLILRRHGSLILSLFAMMISTGLPELSSEKDLNYLRETLVLDLSENEALLH 1039

Query: 62   FRSKFGEALANSWKTSLNWASHNLAKNNK 90
            FRSKF EALANSWKTSLNWASHNLAKNNK
Sbjct: 1040 FRSKFCEALANSWKTSLNWASHNLAKNNK 1068

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195391029|ref|XP_002054168.1| GJ24290 [Drosophila virilis] gi|194152254|gb|EDW67688.1| GJ24290 [Drosophila virilis] Back     alignment and taxonomy information
>gi|328720441|ref|XP_001946655.2| PREDICTED: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform-like isoform 1 [Acyrthosiphon pisum] gi|328720443|ref|XP_003247032.1| PREDICTED: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195055105|ref|XP_001994461.1| GH16124 [Drosophila grimshawi] gi|193892224|gb|EDV91090.1| GH16124 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195113045|ref|XP_002001080.1| GI22170 [Drosophila mojavensis] gi|193917674|gb|EDW16541.1| GI22170 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|157132832|ref|XP_001662660.1| phosphatidylinositol 3-kinase catalytic subunit alpha, beta, delta [Aedes aegypti] gi|108881623|gb|EAT45848.1| AAEL002903-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|194899718|ref|XP_001979405.1| GG15290 [Drosophila erecta] gi|190651108|gb|EDV48363.1| GG15290 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195498258|ref|XP_002096446.1| GE25053 [Drosophila yakuba] gi|194182547|gb|EDW96158.1| GE25053 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195449691|ref|XP_002072182.1| GK22711 [Drosophila willistoni] gi|194168267|gb|EDW83168.1| GK22711 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|307196204|gb|EFN77861.1| Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query90
FB|FBgn00152791088 Pi3K92E "Pi3K92E" [Drosophila 0.977 0.080 0.795 2.1e-32
UNIPROTKB|E1BE661026 PIK3CD "Uncharacterized protei 0.977 0.085 0.579 1.1e-23
MGI|MGI:10982111043 Pik3cd "phosphatidylinositol 3 0.977 0.084 0.579 1.2e-23
UNIPROTKB|E2QW081044 PIK3CD "Uncharacterized protei 0.977 0.084 0.579 1.2e-23
UNIPROTKB|O003291044 PIK3CD "Phosphatidylinositol 4 0.977 0.084 0.579 1.2e-23
UNIPROTKB|F1RIH51044 PIK3CD "Uncharacterized protei 0.977 0.084 0.579 1.2e-23
UNIPROTKB|Q5SR501068 PIK3CD "Phosphatidylinositol 4 0.977 0.082 0.579 1.2e-23
UNIPROTKB|F1NHX11046 PIK3CD "Uncharacterized protei 0.977 0.084 0.545 8.4e-23
UNIPROTKB|I3LNC3257 LOC100622559 "Uncharacterized 0.955 0.334 0.5 4.9e-21
ZFIN|ZDB-GENE-040426-11281039 pik3cd "phosphoinositide-3-kin 0.977 0.084 0.511 1.5e-20
FB|FBgn0015279 Pi3K92E "Pi3K92E" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 366 (133.9 bits), Expect = 2.1e-32, P = 2.1e-32
 Identities = 70/88 (79%), Positives = 78/88 (88%)

Query:     3 FNTQCERAFKILREHGSLILSLFAMMISTGLPELSSEKDVNYLRETLVLDLTEEDAIKHF 62
             F   CERAF +LR+HG LILSLF+MMISTGLPELSSEKD++YLRETLVLD TEE A +HF
Sbjct:  1000 FQELCERAFLVLRKHGCLILSLFSMMISTGLPELSSEKDLDYLRETLVLDYTEEKAREHF 1059

Query:    63 RSKFGEALANSWKTSLNWASHNLAKNNK 90
             R+KF EALANSWKTSLNWASHN +KNNK
Sbjct:  1060 RAKFSEALANSWKTSLNWASHNFSKNNK 1087
GO:0046934 "phosphatidylinositol-4,5-bisphosphate 3-kinase activity" evidence=ISS;IDA
GO:0005943 "1-phosphatidylinositol-4-phosphate 3-kinase, class IA complex" evidence=NAS;IPI
GO:0046854 "phosphatidylinositol phosphorylation" evidence=ISS;IDA;TAS
GO:0046622 "positive regulation of organ growth" evidence=NAS;IMP
GO:0016303 "1-phosphatidylinositol-3-kinase activity" evidence=ISS;NAS;IDA
GO:0035005 "1-phosphatidylinositol-4-phosphate 3-kinase activity" evidence=ISS;IDA
GO:0035004 "phosphatidylinositol 3-kinase activity" evidence=ISS
GO:0045572 "positive regulation of imaginal disc growth" evidence=IMP
GO:0042127 "regulation of cell proliferation" evidence=IMP
GO:0008361 "regulation of cell size" evidence=NAS;IMP
GO:0045927 "positive regulation of growth" evidence=TAS
GO:0045793 "positive regulation of cell size" evidence=TAS
GO:0016310 "phosphorylation" evidence=NAS
GO:0046620 "regulation of organ growth" evidence=NAS
GO:0030307 "positive regulation of cell growth" evidence=NAS;TAS
GO:0008286 "insulin receptor signaling pathway" evidence=NAS;TAS
GO:0016049 "cell growth" evidence=TAS
GO:0040014 "regulation of multicellular organism growth" evidence=IMP;NAS
GO:0048015 "phosphatidylinositol-mediated signaling" evidence=IEA
GO:0006914 "autophagy" evidence=IMP
GO:0007436 "larval salivary gland morphogenesis" evidence=IMP
GO:0030536 "larval feeding behavior" evidence=IMP
GO:0002168 "instar larval development" evidence=IMP
GO:0007552 "metamorphosis" evidence=IMP
GO:0002164 "larval development" evidence=IMP
GO:0006979 "response to oxidative stress" evidence=IMP
GO:0055115 "entry into diapause" evidence=IMP
GO:0060074 "synapse maturation" evidence=IDA
GO:0048169 "regulation of long-term neuronal synaptic plasticity" evidence=IDA
GO:0048813 "dendrite morphogenesis" evidence=IDA
GO:0048477 "oogenesis" evidence=IMP
GO:0001727 "lipid kinase activity" evidence=IDA
GO:0007390 "germ-band shortening" evidence=IMP
GO:0045727 "positive regulation of translation" evidence=IMP
GO:0050773 "regulation of dendrite development" evidence=IMP
GO:2000377 "regulation of reactive oxygen species metabolic process" evidence=IGI
GO:0051124 "synaptic growth at neuromuscular junction" evidence=IMP
GO:0051823 "regulation of synapse structural plasticity" evidence=IMP
UNIPROTKB|E1BE66 PIK3CD "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1098211 Pik3cd "phosphatidylinositol 3-kinase catalytic delta polypeptide" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2QW08 PIK3CD "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O00329 PIK3CD "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RIH5 PIK3CD "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5SR50 PIK3CD "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHX1 PIK3CD "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LNC3 LOC100622559 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1128 pik3cd "phosphoinositide-3-kinase, catalytic, delta polypeptide" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O00329PK3CD_HUMAN2, ., 7, ., 1, ., 1, 5, 30.57950.97770.0842yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
cd05165366 cd05165, PI3Kc_I, Phosphoinositide 3-kinase (PI3K) 3e-40
cd00891352 cd00891, PI3Kc, Phosphoinositide 3-kinase (PI3K), 2e-31
cd05174361 cd05174, PI3Kc_IA_delta, Phosphoinositide 3-kinase 5e-31
cd05173362 cd05173, PI3Kc_IA_beta, Phosphoinositide 3-kinase 4e-29
cd05166353 cd05166, PI3Kc_II, Phosphoinositide 3-kinase (PI3K 2e-20
cd05175366 cd05175, PI3Kc_IA_alpha, Phosphoinositide 3-kinase 1e-18
cd00894365 cd00894, PI3Kc_IB_gamma, Phosphoinositide 3-kinase 2e-17
cd00896350 cd00896, PI3Kc_III, Phosphoinositide 3-kinase (PI3 4e-15
cd05176353 cd05176, PI3Kc_C2_alpha, Phosphoinositide 3-kinase 2e-12
cd00895354 cd00895, PI3Kc_C2_beta, Phosphoinositide 3-kinase 3e-12
cd05177354 cd05177, PI3Kc_C2_gamma, Phosphoinositide 3-kinase 5e-12
smart00146240 smart00146, PI3Kc, Phosphoinositide 3-kinase, cata 2e-08
cd00893289 cd00893, PI4Kc_III, Phosphoinositide 4-kinase (PI4 4e-07
pfam00454233 pfam00454, PI3_PI4_kinase, Phosphatidylinositol 3- 7e-05
cd05167311 cd05167, PI4Kc_III_alpha, Phosphoinositide 4-kinas 1e-04
cd05168293 cd05168, PI4Kc_III_beta, Phosphoinositide 4-kinase 0.001
cd00142219 cd00142, PI3Kc_like, Phosphoinositide 3-kinase (PI 0.004
>gnl|CDD|119425 cd05165, PI3Kc_I, Phosphoinositide 3-kinase (PI3K), class I, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information 
 Score =  135 bits (341), Expect = 3e-40
 Identities = 44/85 (51%), Positives = 62/85 (72%)

Query: 3   FNTQCERAFKILREHGSLILSLFAMMISTGLPELSSEKDVNYLRETLVLDLTEEDAIKHF 62
           F   CE+A+  LR HG+L++ LF+MM+ +GLPEL+S++D+ YLR+TL L  +EE+A+K+F
Sbjct: 282 FQDLCEKAYLALRRHGNLLIILFSMMLMSGLPELTSKEDIEYLRDTLALGKSEEEALKYF 341

Query: 63  RSKFGEALANSWKTSLNWASHNLAK 87
             KF EAL  SW T  NW SH + K
Sbjct: 342 LDKFNEALDGSWTTKFNWFSHLVLK 366

PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. In vitro, they can also phosphorylate the substrates PtdIns and PtdIns(4)P. Class I enzymes are heterodimers and exist in multiple isoforms consisting of one catalytic subunit (out of four isoforms) and one of several regulatory subunits. They are further classified into class IA (alpha, beta and delta) and IB (gamma). Length = 366
>gnl|CDD|119417 cd00891, PI3Kc, Phosphoinositide 3-kinase (PI3K), catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>gnl|CDD|119434 cd05174, PI3Kc_IA_delta, Phosphoinositide 3-kinase (PI3K), class IA, delta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>gnl|CDD|119433 cd05173, PI3Kc_IA_beta, Phosphoinositide 3-kinase (PI3K), class IA, beta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>gnl|CDD|119426 cd05166, PI3Kc_II, Phosphoinositide 3-kinase (PI3K), class II, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>gnl|CDD|88554 cd05175, PI3Kc_IA_alpha, Phosphoinositide 3-kinase (PI3K), class IA, alpha isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>gnl|CDD|119420 cd00894, PI3Kc_IB_gamma, Phosphoinositide 3-kinase (PI3K), class IB, gamma isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>gnl|CDD|119422 cd00896, PI3Kc_III, Phosphoinositide 3-kinase (PI3K), class III, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>gnl|CDD|119435 cd05176, PI3Kc_C2_alpha, Phosphoinositide 3-kinase (PI3K), class II, alpha isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>gnl|CDD|119421 cd00895, PI3Kc_C2_beta, Phosphoinositide 3-kinase (PI3K), class II, beta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>gnl|CDD|119436 cd05177, PI3Kc_C2_gamma, Phosphoinositide 3-kinase (PI3K), class II, gamma isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>gnl|CDD|214538 smart00146, PI3Kc, Phosphoinositide 3-kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|119419 cd00893, PI4Kc_III, Phosphoinositide 4-kinase (PI4K), Type III, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>gnl|CDD|189554 pfam00454, PI3_PI4_kinase, Phosphatidylinositol 3- and 4-kinase Back     alignment and domain information
>gnl|CDD|119427 cd05167, PI4Kc_III_alpha, Phosphoinositide 4-kinase (PI4K), Type III, alpha isoform, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>gnl|CDD|119428 cd05168, PI4Kc_III_beta, Phosphoinositide 4-kinase (PI4K), Type III, beta isoform, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>gnl|CDD|119416 cd00142, PI3Kc_like, Phosphoinositide 3-kinase (PI3K)-like family, catalytic domain; The PI3K-like catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 90
cd00895354 PI3Kc_C2_beta Phosphoinositide 3-kinase (PI3K), cl 99.97
cd05176353 PI3Kc_C2_alpha Phosphoinositide 3-kinase (PI3K), c 99.97
cd05175366 PI3Kc_IA_alpha Phosphoinositide 3-kinase (PI3K), c 99.97
cd05177354 PI3Kc_C2_gamma Phosphoinositide 3-kinase (PI3K), c 99.96
cd05173362 PI3Kc_IA_beta Phosphoinositide 3-kinase (PI3K), cl 99.96
cd05174361 PI3Kc_IA_delta Phosphoinositide 3-kinase (PI3K), c 99.96
cd00894365 PI3Kc_IB_gamma Phosphoinositide 3-kinase (PI3K), c 99.95
cd05165366 PI3Kc_I Phosphoinositide 3-kinase (PI3K), class I, 99.95
cd05166353 PI3Kc_II Phosphoinositide 3-kinase (PI3K), class I 99.95
cd00891352 PI3Kc Phosphoinositide 3-kinase (PI3K), catalytic 99.94
cd05167311 PI4Kc_III_alpha Phosphoinositide 4-kinase (PI4K), 99.93
KOG0904|consensus1076 99.93
cd00896350 PI3Kc_III Phosphoinositide 3-kinase (PI3K), class 99.93
KOG0905|consensus 1639 99.92
cd00893289 PI4Kc_III Phosphoinositide 4-kinase (PI4K), Type I 99.92
KOG0906|consensus843 99.9
cd05168293 PI4Kc_III_beta Phosphoinositide 4-kinase (PI4K), T 99.9
KOG0903|consensus847 99.86
KOG0902|consensus1803 99.84
COG50322105 TEL1 Phosphatidylinositol kinase and protein kinas 98.71
smart00146202 PI3Kc Phosphoinositide 3-kinase, catalytic domain. 97.69
PF00454235 PI3_PI4_kinase: Phosphatidylinositol 3- and 4-kina 96.68
cd00142219 PI3Kc_like Phosphoinositide 3-kinase (PI3K)-like f 96.54
cd00892237 PIKKc_ATR ATR (Ataxia telangiectasia and Rad3-rela 95.28
cd05164222 PIKKc Phosphoinositide 3-kinase-related protein ki 94.95
cd05169280 PIKKc_TOR TOR (Target of rapamycin), catalytic dom 94.57
cd05171279 PIKKc_ATM Ataxia telangiectasia mutated (ATM), cat 93.41
cd05172235 PIKKc_DNA-PK DNA-dependent protein kinase (DNA-PK) 89.65
cd05170307 PIKKc_SMG1 Suppressor of morphogenetic effect on g 87.9
PLN0215096 terpene synthase/cyclase family protein 86.94
KOG2001|consensus 734 80.84
>cd00895 PI3Kc_C2_beta Phosphoinositide 3-kinase (PI3K), class II, beta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information 
Probab=99.97  E-value=9.3e-31  Score=197.45  Aligned_cols=86  Identities=37%  Similarity=0.578  Sum_probs=83.8

Q ss_pred             ChHHHHHHHHHHHHHhchHHHHHHHHHHhhCCCCCCCChhHHHHHHHHccCCCCHHHHHHHHHHHHHHHhcCchhHHHHH
Q psy11388          1 MLFNTQCERAFKILREHGSLILSLFAMMISTGLPELSSEKDVNYLRETLVLDLTEEDAIKHFRSKFGEALANSWKTSLNW   80 (90)
Q Consensus         1 ~~F~~lc~~ay~~lR~~~~lil~L~~lM~~sgiP~l~~~~~i~~l~~rl~l~~sd~eA~~~f~~lI~~s~~~s~~t~~~d   80 (90)
                      ++|+++||+||++||+|+++|++||+||++|||||++..+++.++++||+|++||+||..||.++|++|++ +|+|++||
T Consensus       269 ~~F~~lc~~ay~~lRk~~~~il~L~~lM~~sgiP~l~~~~~i~~l~~rf~l~~se~eA~~~f~~lI~~s~~-s~~t~~~~  347 (354)
T cd00895         269 HDFVDLCCQAYNLIRKHTHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPQDTEADATTYFTRLIESSLG-SVATKLNF  347 (354)
T ss_pred             HHHHHHHHHHHHHHHHhHHHHHHHHHHHHcCCCcccCcchHHHHHHHHhCCCCCHHHHHHHHHHHHHHHHh-hhhHhHHH
Confidence            47999999999999999999999999999999999999889999999999999999999999999999998 89999999


Q ss_pred             HHHHhhh
Q psy11388         81 ASHNLAK   87 (90)
Q Consensus        81 ~iH~~a~   87 (90)
                      ++|++||
T Consensus       348 ~~H~~aq  354 (354)
T cd00895         348 FIHNLAQ  354 (354)
T ss_pred             HHHHhcC
Confidence            9999998

PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class II PI3Ks preferentially use PtdIns as a substrate to produce PtdIns(3)P, but can also phosphorylate PtdIns(4)P. They function as monomers and do not
>cd05176 PI3Kc_C2_alpha Phosphoinositide 3-kinase (PI3K), class II, alpha isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>cd05175 PI3Kc_IA_alpha Phosphoinositide 3-kinase (PI3K), class IA, alpha isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>cd05177 PI3Kc_C2_gamma Phosphoinositide 3-kinase (PI3K), class II, gamma isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>cd05173 PI3Kc_IA_beta Phosphoinositide 3-kinase (PI3K), class IA, beta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>cd05174 PI3Kc_IA_delta Phosphoinositide 3-kinase (PI3K), class IA, delta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>cd00894 PI3Kc_IB_gamma Phosphoinositide 3-kinase (PI3K), class IB, gamma isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>cd05165 PI3Kc_I Phosphoinositide 3-kinase (PI3K), class I, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>cd05166 PI3Kc_II Phosphoinositide 3-kinase (PI3K), class II, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>cd00891 PI3Kc Phosphoinositide 3-kinase (PI3K), catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>cd05167 PI4Kc_III_alpha Phosphoinositide 4-kinase (PI4K), Type III, alpha isoform, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>KOG0904|consensus Back     alignment and domain information
>cd00896 PI3Kc_III Phosphoinositide 3-kinase (PI3K), class III, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>KOG0905|consensus Back     alignment and domain information
>cd00893 PI4Kc_III Phosphoinositide 4-kinase (PI4K), Type III, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>KOG0906|consensus Back     alignment and domain information
>cd05168 PI4Kc_III_beta Phosphoinositide 4-kinase (PI4K), Type III, beta isoform, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>KOG0903|consensus Back     alignment and domain information
>KOG0902|consensus Back     alignment and domain information
>COG5032 TEL1 Phosphatidylinositol kinase and protein kinases of the PI-3 kinase family [Signal transduction mechanisms / Cell division and chromosome partitioning / Chromatin structure and dynamics / DNA replication, recombination, and repair / Intracellular trafficking and secretion] Back     alignment and domain information
>smart00146 PI3Kc Phosphoinositide 3-kinase, catalytic domain Back     alignment and domain information
>PF00454 PI3_PI4_kinase: Phosphatidylinositol 3- and 4-kinase; InterPro: IPR000403 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd00142 PI3Kc_like Phosphoinositide 3-kinase (PI3K)-like family, catalytic domain; The PI3K-like catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>cd00892 PIKKc_ATR ATR (Ataxia telangiectasia and Rad3-related), catalytic domain; The ATR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>cd05164 PIKKc Phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily, catalytic domain; The PIKK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>cd05169 PIKKc_TOR TOR (Target of rapamycin), catalytic domain; The TOR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>cd05171 PIKKc_ATM Ataxia telangiectasia mutated (ATM), catalytic domain; The ATM catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>cd05172 PIKKc_DNA-PK DNA-dependent protein kinase (DNA-PK), catalytic domain; The DNA-PK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>cd05170 PIKKc_SMG1 Suppressor of morphogenetic effect on genitalia-1 (SMG-1), catalytic domain; The SMG-1 catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases Back     alignment and domain information
>PLN02150 terpene synthase/cyclase family protein Back     alignment and domain information
>KOG2001|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
4ajw_A934 Discovery And Optimization Of New Benzimidazole- An 1e-26
2wxf_A940 The Crystal Structure Of The Murine Class Ia Pi 3-K 1e-26
2y3a_A1092 Crystal Structure Of P110beta In Complex With Icsh2 1e-22
3hhm_A1091 Crystal Structure Of P110alpha H1047r Mutant In Com 2e-16
3hiz_A1096 Crystal Structure Of P110alpha H1047r Mutant In Com 2e-16
4a55_A1096 Crystal Structure Of P110alpha In Complex With Ish2 3e-16
2rd0_A1096 Structure Of A Human P110alpha/p85alpha Complex Len 3e-16
4anv_A980 Complexes Of Pi3kgamma With Isoform Selective Inhib 1e-13
1e8x_A961 Structural Insights Into Phoshoinositide 3-Kinase E 2e-13
1e7u_A961 Structure Determinants Of Phosphoinositide 3-Kinase 2e-13
3l54_A966 Structure Of Pi3k Gamma With Inhibitor Length = 966 3e-13
3nzs_A954 Structure-Based Optimization Of Pyrazolo -Pyrimidin 3e-13
4anx_A980 Complexes Of Pi3kgamma With Isoform Selective Inhib 3e-13
4anu_A980 Complexes Of Pi3kgamma With Isoform Selective Inhib 3e-13
3apc_A966 Crystal Structure Of Human Pi3k-Gamma In Complex Wi 3e-13
3qaq_A960 Crystal Structure Of Pi3k-Gamma In Complex With Tri 3e-13
1he8_A965 Ras G12v-Pi 3-Kinase Gamma Complex Length = 965 3e-13
1e8y_A966 Structure Determinants Of Phosphoinositide 3-Kinase 3e-13
4dk5_A959 Crystal Structure Of Human Pi3k-Gamma In Complex Wi 3e-13
3ene_A959 Complex Of Pi3k Gamma With An Inhibitor Length = 95 3e-13
3dbs_A960 Structure Of Pi3k Gamma In Complex With Gdc0941 Len 3e-13
3cst_A966 Crystal Structure Of Pi3k P110gamma Catalytical Dom 3e-13
3zim_A940 Discovery Of A Potent And Isoform-selective Targete 1e-12
2x6f_A696 The Crystal Structure Of The Drosophila Class Iii P 8e-08
3ihy_A600 Human Pik3c3 Crystal Structure Length = 600 3e-07
3ls8_A614 Crystal Structure Of Human Pik3c3 In Complex With 3 4e-07
>pdb|4AJW|A Chain A, Discovery And Optimization Of New Benzimidazole- And Benzoxazole- Pyrimidone Selective Pi3kbeta Inhibitors For The Treatment Of Phosphatase And Tensin Homologue (Pten)-Deficient Cancers Length = 934 Back     alignment and structure 
Iteration: 1

 Score =  114 bits (286), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 51/88 (57%), Positives = 66/88 (75%)
Query: 3   FNTQCERAFKILREHGSLILSLFAMMISTGLPELSSEKDVNYLRETLVLDLTEEDAIKHF 62
           F   CERA+ ILR HG L L LFA+M + GLPELS  KD+ YL+++L L  TEE+A+KHF
Sbjct: 846 FRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHF 905
Query: 63  RSKFGEALANSWKTSLNWASHNLAKNNK 90
           R KF EAL  SWKT +NW +HN++K+N+
Sbjct: 906 RVKFNEALRESWKTKVNWLAHNVSKDNR 933
>pdb|2WXF|A Chain A, The Crystal Structure Of The Murine Class Ia Pi 3-Kinase P110delta In Complex With Pik-39. Length = 940 Back     alignment and structure
>pdb|2Y3A|A Chain A, Crystal Structure Of P110beta In Complex With Icsh2 Of P85beta And The Drug Gdc-0941 Length = 1092 Back     alignment and structure
>pdb|3HHM|A Chain A, Crystal Structure Of P110alpha H1047r Mutant In Complex With Nish2 Of P85alpha And The Drug Wortmannin Length = 1091 Back     alignment and structure
>pdb|3HIZ|A Chain A, Crystal Structure Of P110alpha H1047r Mutant In Complex With Nish2 Of P85alpha Length = 1096 Back     alignment and structure
>pdb|4A55|A Chain A, Crystal Structure Of P110alpha In Complex With Ish2 Of P85alpha And The Inhibitor Pik-108 Length = 1096 Back     alignment and structure
>pdb|2RD0|A Chain A, Structure Of A Human P110alpha/p85alpha Complex Length = 1096 Back     alignment and structure
>pdb|4ANV|A Chain A, Complexes Of Pi3kgamma With Isoform Selective Inhibitors Length = 980 Back     alignment and structure
>pdb|1E8X|A Chain A, Structural Insights Into Phoshoinositide 3-Kinase Enzymatic Mechanism And Signalling Length = 961 Back     alignment and structure
>pdb|3L54|A Chain A, Structure Of Pi3k Gamma With Inhibitor Length = 966 Back     alignment and structure
>pdb|3NZS|A Chain A, Structure-Based Optimization Of Pyrazolo -Pyrimidine And -Pyridine Inhibitors Of Pi3-Kinase Length = 954 Back     alignment and structure
>pdb|4ANX|A Chain A, Complexes Of Pi3kgamma With Isoform Selective Inhibitors Length = 980 Back     alignment and structure
>pdb|4ANU|A Chain A, Complexes Of Pi3kgamma With Isoform Selective Inhibitors. Length = 980 Back     alignment and structure
>pdb|3APC|A Chain A, Crystal Structure Of Human Pi3k-Gamma In Complex With Ch5132799 Length = 966 Back     alignment and structure
>pdb|3QAQ|A Chain A, Crystal Structure Of Pi3k-Gamma In Complex With Triazine-Benzimidazole 1 Length = 960 Back     alignment and structure
>pdb|1HE8|A Chain A, Ras G12v-Pi 3-Kinase Gamma Complex Length = 965 Back     alignment and structure
>pdb|1E8Y|A Chain A, Structure Determinants Of Phosphoinositide 3-Kinase Inhibition By Wortmannin, Ly294002, Quercetin, Myricetin And Staurosporine Length = 966 Back     alignment and structure
>pdb|4DK5|A Chain A, Crystal Structure Of Human Pi3k-Gamma In Complex With A Pyridyl- Triazine Inhibitor Length = 959 Back     alignment and structure
>pdb|3ENE|A Chain A, Complex Of Pi3k Gamma With An Inhibitor Length = 959 Back     alignment and structure
>pdb|3DBS|A Chain A, Structure Of Pi3k Gamma In Complex With Gdc0941 Length = 960 Back     alignment and structure
>pdb|3CST|A Chain A, Crystal Structure Of Pi3k P110gamma Catalytical Domain In Complex With Organoruthenium Inhibitor E5e2 Length = 966 Back     alignment and structure
>pdb|3ZIM|A Chain A, Discovery Of A Potent And Isoform-selective Targeted Covalent Inhibitor Of The Lipid Kinase Pi3kalpha Length = 940 Back     alignment and structure
>pdb|2X6F|A Chain A, The Crystal Structure Of The Drosophila Class Iii Pi3-Kinase Vps34 In Complex With 3-Methyladenine Length = 696 Back     alignment and structure
>pdb|3IHY|A Chain A, Human Pik3c3 Crystal Structure Length = 600 Back     alignment and structure
>pdb|3LS8|A Chain A, Crystal Structure Of Human Pik3c3 In Complex With 3-[4-(4- Morpholinyl)thieno[3,2-D]pyrimidin-2-Yl]-Phenol Length = 614 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
2wxf_A940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 1e-28
2y3a_A1092 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 3e-27
3hhm_A1091 Phosphatidylinositol-4,5-bisphosphate 3-kinase cat 4e-26
1e7u_A961 Phosphatidylinositol 3-kinase catalytic subunit; p 6e-25
2x6h_A696 GH13170P, VPS34, phosphotidylinositol 3 kinase 59F 2e-22
3ls8_A614 Phosphatidylinositol 3-kinase catalytic subunit ty 7e-21
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Length = 940 Back     alignment and structure
 Score =  106 bits (264), Expect = 1e-28
 Identities = 51/88 (57%), Positives = 66/88 (75%)

Query: 3   FNTQCERAFKILREHGSLILSLFAMMISTGLPELSSEKDVNYLRETLVLDLTEEDAIKHF 62
           F   CERA+ ILR HG L L LFA+M + GLPELS  KD+ YL+++L L  TEE+A+KHF
Sbjct: 852 FRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHF 911

Query: 63  RSKFGEALANSWKTSLNWASHNLAKNNK 90
           R KF EAL  SWKT +NW +HN++K+N+
Sbjct: 912 RVKFNEALRESWKTKVNWLAHNVSKDNR 939
>2y3a_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit beta isoform; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 1092 Back     alignment and structure
>3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A Length = 1091 Back     alignment and structure
>2x6h_A GH13170P, VPS34, phosphotidylinositol 3 kinase 59F; transferase; 2.90A {Drosophila melanogaster} PDB: 2x6f_A 2x6i_A* 2x6j_A* 2x6k_A* Length = 696 Back     alignment and structure
>3ls8_A Phosphatidylinositol 3-kinase catalytic subunit type 3; alpha/beta protein, PIK3C3, compound 15E, structural genomics, SGC stockholm; HET: AJZ; 2.25A {Homo sapiens} PDB: 3ihy_A Length = 614 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query90
3hhm_A1091 Phosphatidylinositol-4,5-bisphosphate 3-kinase cat 99.92
2wxf_A940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 99.9
2y3a_A1092 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 99.89
3ls8_A614 Phosphatidylinositol 3-kinase catalytic subunit ty 99.87
1e7u_A961 Phosphatidylinositol 3-kinase catalytic subunit; p 99.86
2x6h_A696 GH13170P, VPS34, phosphotidylinositol 3 kinase 59F 99.85
1fsh_A105 Dishevelled-1; three-helix bundle, beta-ARM, signa 81.92
>3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A Back     alignment and structure
Probab=99.92  E-value=7.5e-26  Score=187.31  Aligned_cols=89  Identities=35%  Similarity=0.750  Sum_probs=82.3

Q ss_pred             hHHHHHHHHHHHHHhchHHHHHHHHHHhhCCCCCCCChhHHHHHHHHccCCCCHHHHHHHHHHHHHHHhcCchhHHHHHH
Q psy11388          2 LFNTQCERAFKILREHGSLILSLFAMMISTGLPELSSEKDVNYLRETLVLDLTEEDAIKHFRSKFGEALANSWKTSLNWA   81 (90)
Q Consensus         2 ~F~~lc~~ay~~lR~~~~lil~L~~lM~~sgiP~l~~~~~i~~l~~rl~l~~sd~eA~~~f~~lI~~s~~~s~~t~~~d~   81 (90)
                      .|+++|+.||++||+|+++|++||++|+++||||+++.+++.+|++||+|++||+||+++|.++|++|++++|+|++||+
T Consensus      1002 ~Fr~~c~~a~~~LR~~~~~il~LlelM~~s~lp~~~~~~~i~~lr~rf~l~lseeeA~~~f~~~i~~s~~~~~~t~~n~~ 1081 (1091)
T 3hhm_A         1002 RFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDARHGGWTTKMDWI 1081 (1091)
T ss_dssp             HHHHHHHHHHHHHHHTTTHHHHHHHHGGGSCCTTCSSHHHHHHHHHHSCCSSCHHHHHHHHHHHHHHCCCCCCCSSSCSS
T ss_pred             HHHHHHHHHHHHHHhhhHHHHHHHHHHhcCCCCccCchHHHHHHHHHhCCCCCHHHHHHHHHHHHHHHHhcCceeehhHH
Confidence            69999999999999999999999999999999999998899999999999999999999999999999977899999999


Q ss_pred             HHHhhhcCC
Q psy11388         82 SHNLAKNNK   90 (90)
Q Consensus        82 iH~~a~~~~   90 (90)
                      +|++||.|.
T Consensus      1082 ~H~~a~~~~ 1090 (1091)
T 3hhm_A         1082 FHTIKQHAL 1090 (1091)
T ss_dssp             SCCC-----
T ss_pred             HHHhhcccC
Confidence            999999874
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Back     alignment and structure
>2y3a_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit beta isoform; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>3ls8_A Phosphatidylinositol 3-kinase catalytic subunit type 3; alpha/beta protein, PIK3C3, compound 15E, structural genomics, SGC stockholm; HET: AJZ; 2.25A {Homo sapiens} PDB: 3ihy_A Back     alignment and structure
>2x6h_A GH13170P, VPS34, phosphotidylinositol 3 kinase 59F; transferase; 2.90A {Drosophila melanogaster} PDB: 2x6f_A 2x6i_A* 2x6j_A* 2x6k_A* Back     alignment and structure
>1fsh_A Dishevelled-1; three-helix bundle, beta-ARM, signaling protein; NMR {Mus musculus} SCOP: a.4.5.31 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 90
d1e7ua4369 d.144.1.4 (A:726-1094) Phoshoinositide 3-kinase (P 4e-21

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query90
d1e7ua4369 Phoshoinositide 3-kinase (PI3K), catalytic domain 99.87
d1fsha_94 Segment polarity protein Dishevelled-1 {Mouse (Mus 86.78
>d1fsha_ a.4.5.31 (A:) Segment polarity protein Dishevelled-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure