Diaphorina citri psyllid: psy11402


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MSNLDNRIANPDQLLTADLDKFCDMFTDLYSNICKPVLDIVIYVYRLTSTLGYQTPTVMLGYLVVSGVILTHLRRPAGRMTVTEQKLEGEFRYINSRLISNSEEIAFYQGNQREKLTVLAAFNKLVSMSWKGTQY
ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccc
**NLDNRIANPDQLLTADLDKFCDMFTDLYSNICKPVLDIVIYVYRLTSTLGYQTPTVMLGYLVVSGVILTHLRRPAGRMTVTEQKLEGEFRYINSRLISNSEEIAFYQGNQREKLTVLAAFNKLVSMSWKGTQY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNLDNRIANPDQLLTADLDKFCDMFTDLYSNICKPVLDIVIYVYRLTSTLGYQTPTVMLGYLVVSGVILTHLRRPAGRMTVTEQKLEGEFRYINSRLISNSEEIAFYQGNQREKLTVLAAFNKLVSMSWKGTQY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-binding cassette sub-family D member 3 confidentP16970
ATP-binding cassette sub-family D member 3 Probable transporter. The nucleotide-binding fold acts as an ATP-binding subunit with ATPase activity.confidentP28288
ATP-binding cassette sub-family D member 3 confidentP55096

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005782 [CC]peroxisomal matrixprobableGO:0005737, GO:0005575, GO:0043231, GO:0042579, GO:0044464, GO:0043233, GO:0005777, GO:0043229, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0005623, GO:0031907, GO:0044424, GO:0044439, GO:0044438, GO:0043227, GO:0043226, GO:0044422
GO:0005779 [CC]integral to peroxisomal membraneprobableGO:0042579, GO:0043229, GO:0031301, GO:0031300, GO:0043227, GO:0043226, GO:0031224, GO:0005737, GO:0005575, GO:0005778, GO:0031090, GO:0016021, GO:0016020, GO:0005777, GO:0044439, GO:0044438, GO:0031903, GO:0031231, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0007031 [BP]peroxisome organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0016887 [MF]ATPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0042760 [BP]very long-chain fatty acid catabolic processprobableGO:0006631, GO:0072329, GO:0019752, GO:0044248, GO:0009062, GO:0044281, GO:0044282, GO:0044242, GO:0044712, GO:0044710, GO:0016042, GO:0071704, GO:0006629, GO:0009987, GO:1901575, GO:0032787, GO:0008150, GO:0008152, GO:0000038, GO:0043436, GO:0044255, GO:0009056, GO:0044238, GO:0006082, GO:0046395, GO:0016054, GO:0044237
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0006635 [BP]fatty acid beta-oxidationprobableGO:0034440, GO:0006631, GO:0019752, GO:0044248, GO:0009062, GO:0044281, GO:0044282, GO:0044242, GO:0044712, GO:1901575, GO:0030258, GO:0016042, GO:0071704, GO:0006629, GO:0009987, GO:0044710, GO:0032787, GO:0008150, GO:0008152, GO:0072329, GO:0043436, GO:0019395, GO:0044255, GO:0009056, GO:0055114, GO:0044238, GO:0006082, GO:0046395, GO:0016054, GO:0044237
GO:0043621 [MF]protein self-associationprobableGO:0003674, GO:0005488, GO:0005515
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QF4, chain A
Confidence level:probable
Coverage over the Query: 13-131
View the alignment between query and template
View the model in PyMOL