Diaphorina citri psyllid: psy11420

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-----

MTYQKLVSVLESLPKPKPADDAPTSLPRECQGILHPDEHLVPTMKEMGLDESSIPLCKFPGGETEALKRLEKSLANKEWVRKFEKPNTAPNSLEPSTTVLSPYLKFGCLSVRLFYHELKKILATGPHAKPPVSLLGQIYWREFYYVVGSDTPNFDKMKGNKICCQVDWDTNEKYLEAWSHGKTGYPFIDAIMRQLRLEGWIHHLARHAVACFLTRGDLYLSWEEGQSVFEELLLDADWAMNAGNWMWLSASAFFHQFFRVYSPVAFGKKTDKFELLLDADWAMNAGNWMWLSASAFFHQFFRVYSPVAFGKKTDK

ccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcHHHHHHcccccccccccccccccccHHHccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccccccccccHHHcccccccccccccccccccccccccccEEEccccccccccccccccccccccHHHcccHHHcccccc

MTYQKLVSVLESLPKPKPA*************ILHPDEHLVPTMKEMGLDESSIPLCKFPGGETEALKRLEKSLANKEWVRKFEKPNTAPNSLEPSTTVLSPYLKFGCLSVRLFYHELKKILATGPHAKPPVSLLGQIYWREFYYVVGSDTPNFDKMKGNKICCQVDWDTNEKYLEAWSHGKTGYPFIDAIMRQLRLEGWIHHLARHAVACFLTRGDLYLSWEEGQSVFEELLLDADWAMNAGNWMWLSASAFFHQFFRVYSPVAFGKKTDKFELLLDADWAMNAGNWMWLSASAFFHQFFRVYSPVAFG*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
(6-4)DNA photolyase	Involved in repair of UV radiation-induced DNA damage. Catalyzes the photoreactivation of pyrimidine [6-4] pyrimidone photoproduct (6-4 products).	confident	Q0E2Y1
Cryptochrome-1	Blue light-dependent regulator of the circadian feedback loop. Inhibits CLOCK\|NPAS2-ARNTL E box-mediated transcription. Acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. Has no photolyase activity. Capable of translocating circadian clock core proteins such as PER proteins to the nucleus. May inhibit CLOCK\|NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.	confident	Q16526
Cryptochrome-1	Blue light-dependent regulator of the circadian feedback loop. Inhibits CLOCK\|NPAS2-ARNTL E box-mediated transcription. Acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. Has no photolyase activity. Capable of translocating circadian clock core proteins such as PER proteins to the nucleus. May inhibit CLOCK\|NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.	confident	Q8QG61

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0009416 [BP]	response to light stimulus	probable	GO:0009314, GO:0050896, GO:0008150, GO:0009628
GO:0003914 [MF]	DNA (6-4) photolyase activity	probable	GO:0003824, GO:0016829, GO:0016830, GO:0003674, GO:0003913
GO:0000719 [BP]	photoreactive repair	probable	GO:0006290, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0044428 [CC]	nuclear part	probable	GO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0009266 [BP]	response to temperature stimulus	probable	GO:0009628, GO:0050896, GO:0008150
GO:0000122 [BP]	negative regulation of transcription from RNA polymerase II promoter	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0009649 [BP]	entrainment of circadian clock	probable	GO:0009605, GO:0050896, GO:0042752, GO:0065007, GO:0008150, GO:0050789
GO:2000118 [BP]	regulation of sodium-dependent phosphate transport	probable	GO:0044070, GO:0051049, GO:0065007, GO:0008150, GO:0010966, GO:0032879, GO:0050789, GO:0043269
GO:0009881 [MF]	photoreceptor activity	probable	GO:0003674, GO:0038023, GO:0004872, GO:0004871, GO:0060089
GO:0003904 [MF]	deoxyribodipyrimidine photo-lyase activity	probable	GO:0003824, GO:0016829, GO:0016830, GO:0003674, GO:0003913
GO:0031974 [CC]	membrane-enclosed lumen	probable	GO:0005575
GO:0019902 [MF]	phosphatase binding	probable	GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0032515 [BP]	negative regulation of phosphoprotein phosphatase activity	probable	GO:0051336, GO:0051174, GO:0060191, GO:0019220, GO:0043666, GO:0050790, GO:0065009, GO:0010921, GO:0031323, GO:0010923, GO:0019222, GO:0050789, GO:0051004, GO:0065007, GO:0044092, GO:0008150, GO:0035303, GO:0050794, GO:0043086, GO:0051346
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0003690 [MF]	double-stranded DNA binding	probable	GO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0003697 [MF]	single-stranded DNA binding	probable	GO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0000988 [MF]	protein binding transcription factor activity	probable	GO:0003674
GO:0003684 [MF]	damaged DNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0005576 [CC]	extracellular region	probable	GO:0005575

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FY4, chain A
Confidence level:very confident
Coverage over the Query: 1-287
View the alignment between query and template
View the model in PyMOL

Template: 1NP7, chain A
Confidence level:very confident
Coverage over the Query: 221-315
View the alignment between query and template
View the model in PyMOL