Diaphorina citri psyllid: psy1142

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440--

RIKTVTNHTLIVLVSSATPYVELNNEIKDKIKLVMAKRYNGDNKALDLSKFYADPDFVEANMFVPLDRSNVMTSVCNIINENLPDLFALNLSENKLYYPESLISLAKVIPRVKILYLAHNNIKDLATIRTLESLSNLEELRLEKNPWTECFNEQDAYTSEVRKIFPKLLKLDDIQLPPPIVFDLEDNIELPKPQGSFLCHPEARDILRAFLEQYFALFDTESRAGLIDAYHENAQYSLVVTQGLGNNHLLNNMLANSRNLLRIEEPQRQKSLLSVGKADILRALRFLPATKHDLLSFTCDCPLYTPGLIQFSVCGLYEEITTGTKNKSKLIRAFNRAFLLVPRSGGGFAITNDQLFITSATPEQAEKAFSSQVTASESTCSTPVSNEILIKQNMVKALSQVSGMNLNFSEKCLNEVQWDYDQAVTIFNQLKAKNALPSEAFI

ccccccccEEEEEEccccccccccHHHHHHHHHHHHHccccccccCCcccccccccHHccccccccccccHHHHHHHHHHHHcccccEECcccccccccccHHHHHHHcccccEEEccccccccHHHHHHHcccccccEEECcccccccccccccHHHHHHHHHccccEECcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccEEEEEEcccccccccHHHHHHHcccccccccHHHHHHHHcccHHHHHHHHHHcccccccccccccccccccccEEEEEEEEEEEEEcccccccccccEEEEEEEEEEEcccccEEEEccccccccccHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccc

RIK*VTNHTLIVLVSSATPYVELNNEIKDKIKLVMAKRYNGDNKALDLSKFYADPDFVEANMFVPLDRSNVMTSVCNIINENLPDLFALNLSENKLYYPESLISLAKVIPRVKILYLAHNNIKDLATIRTLESLSNLEELRLEKNPWTECFNEQDAYTSEVRKIFPKLLKLDDIQLPPPIVFDLEDNIELPKPQGSFLCHPEARDILRAFLEQYFALFDTESRAGLIDAYHENAQYSLVVTQGLGNNHLLNNMLANSRNLLRIEEPQRQKSLLSVGKADILRALRFLPATKHDLLSFTCDCPLYTPGLIQFSVCGLYEEITTGTKNKSKLIRAFNRAFLLVPRSGGGFAITNDQLFITSATPEQA*********************EILIKQNMVKALSQVSGMNLNFSEKCLNEVQWDYDQAVTIFNQLKAKNALPSEAFI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Nuclear RNA export factor 1	Involved in the nuclear export of mRNA species bearing retroviral constitutive transport elements (CTE) and in the export of mRNA from the nucleus to the cytoplasm. The NXF1-NXT1 heterodimer is involved in the export of HSP70 mRNA in conjunction with ALYREF/THOC4 and THOC5.	confident	Q5R752
Nuclear RNA export factor 1	Involved in the nuclear export of mRNA species bearing retroviral constitutive transport elements (CTE) and in the export of mRNA from the nucleus to the cytoplasm. The NXF1-NXT1 heterodimer is involved in the export of HSP70 mRNA in conjunction with ALYREF/THOC4 and THOC5.	confident	O88984
Nuclear RNA export factor 1	Involved in the nuclear export of mRNA species bearing retroviral constitutive transport elements (CTE) and in the export of mRNA from the nucleus to the cytoplasm. The NXF1-NXT1 heterodimer is involved in the export of HSP70 mRNA in conjunction with ALYREF/THOC4 and THOC5.	confident	Q9UBU9

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005643 [CC]	nuclear pore	probable	GO:0005635, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0031224, GO:0044446, GO:0046930, GO:0016021, GO:0016020, GO:0031967, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044428, GO:0044424, GO:0044425, GO:0005634, GO:0044422
GO:0042405 [CC]	nuclear inclusion body	probable	GO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0016234, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003729 [MF]	mRNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0015629 [CC]	actin cytoskeleton	probable	GO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005487 [MF]	nucleocytoplasmic transporter activity	probable	GO:0005215, GO:0003674
GO:0006406 [BP]	mRNA export from nucleus	probable	GO:0015931, GO:0051169, GO:0051168, GO:0016482, GO:0051028, GO:0044699, GO:0071705, GO:0071702, GO:0033036, GO:0006405, GO:0009987, GO:0006810, GO:0006913, GO:0044763, GO:0051649, GO:0051236, GO:0051234, GO:0051179, GO:0051641, GO:0050658, GO:0006403, GO:0046907, GO:0050657, GO:0008150

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RW6, chain A
Confidence level:very confident
Coverage over the Query: 1-182
View the alignment between query and template
View the model in PyMOL

Template: 1JKG, chain B
Confidence level:very confident
Coverage over the Query: 190-371
View the alignment between query and template
View the model in PyMOL