Psyllid ID: psy1142
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 442 | 2.2.26 [Sep-21-2011] | |||||||
| O88984 | 618 | Nuclear RNA export factor | yes | N/A | 0.961 | 0.687 | 0.386 | 3e-82 | |
| Q99JX7 | 618 | Nuclear RNA export factor | yes | N/A | 0.984 | 0.703 | 0.361 | 5e-80 | |
| Q9UBU9 | 619 | Nuclear RNA export factor | yes | N/A | 0.959 | 0.684 | 0.376 | 7e-79 | |
| P58797 | 616 | Nuclear RNA export factor | N/A | N/A | 0.984 | 0.706 | 0.366 | 2e-78 | |
| Q1RMS5 | 620 | Nuclear RNA export factor | yes | N/A | 0.936 | 0.667 | 0.380 | 2e-76 | |
| Q5R752 | 626 | Nuclear RNA export factor | yes | N/A | 0.959 | 0.677 | 0.366 | 2e-76 | |
| Q9U1H9 | 672 | Nuclear RNA export factor | yes | N/A | 0.975 | 0.641 | 0.341 | 4e-72 | |
| Q9GZY0 | 626 | Nuclear RNA export factor | no | N/A | 0.968 | 0.683 | 0.337 | 1e-67 | |
| Q9XVS7 | 628 | Nuclear RNA export factor | yes | N/A | 0.932 | 0.656 | 0.312 | 4e-47 | |
| Q9Y8G3 | 596 | mRNA export factor mex67 | yes | N/A | 0.911 | 0.676 | 0.282 | 9e-31 |
| >sp|O88984|NXF1_RAT Nuclear RNA export factor 1 OS=Rattus norvegicus GN=Nxf1 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 306 bits (783), Expect = 3e-82, Method: Compositional matrix adjust.
Identities = 169/437 (38%), Positives = 261/437 (59%), Gaps = 12/437 (2%)
Query: 11 IVLVSSATPYV---ELNNEIKDKIKLVMAKRYNGDNKALDLSKFYADPDFVEANMFVPLD 67
I++ SSA PY+ EL E +++KL+M+KRY+G +ALDL +DPD V N+ V L+
Sbjct: 188 IIINSSAPPYIVQNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLN 247
Query: 68 RSNVMTSVCNIINENLPDLFALNLSENKLYYPESLISLAKVIPRVKILYLAHNNIKDLAT 127
R M + II EN+P+L +LNLS N+LY + + S+ + P +KIL L+ N +K
Sbjct: 248 RRGCMAAALRIIEENIPELLSLNLSNNRLYKLDDMSSIVQKAPNLKILNLSGNELKSEWE 307
Query: 128 IRTLESLSNLEELRLEKNPWTECFNEQDAYTSEVRKIFPKLLKLDDIQLPPPIVFDLEDN 187
+ ++ L LEEL L++NP + F +Q Y S +R+ FPKLL+LD +LPPPI FD+E
Sbjct: 308 LDKIKGLK-LEELWLDRNPMCDTFLDQSTYISTIRERFPKLLRLDGHELPPPIAFDVEAP 366
Query: 188 IELPKPQGSFLCHPEARDILRAFLEQYFALFDTESRAGLIDAYHENAQYSLVVTQGLGN- 246
LP +GS+ + ++ FL+QY+A++D+ R GL+DAYH+ A SL N
Sbjct: 367 TMLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSTPSNPQNP 426
Query: 247 -NHLLNNMLANSRNLLRIEEPQRQKSLLSVGKADILRALRFLPATKHDLLSFTCDCPLYT 305
H L +SRN+ +I++ + LL + +++ L LP T HD+ SF D T
Sbjct: 427 VRHNLAKYFNDSRNVKKIKDTTTRFRLLKHTRLNVVAFLNELPKTHHDVNSFVVDISAQT 486
Query: 306 PGLIQFSVCGLYEEITTGTKNKSKLIRAFNRAFLLVPRSGGGFAITNDQLFITSATPEQA 365
L+ FSV G+++E+ +++ +RAF R F+ VP S G I ND+LF+ +A+PE+
Sbjct: 487 STLLCFSVNGVFKEVDGKSRDS---LRAFTRTFIAVPASNSGLCIVNDELFVRNASPEEI 543
Query: 366 EKAFSSQVTASESTCSTPVSNEILIKQNMVKALSQVSGMNLNFSEKCLNEVQWDYDQAVT 425
++AF+ + + S+PV +Q+M++A S SGMNL +S+KCL + WDY ++
Sbjct: 544 QRAFA---MPAPTPSSSPVPTLSQEQQDMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQ 600
Query: 426 IFNQLKAKNALPSEAFI 442
F LKAK +P AF+
Sbjct: 601 AFTHLKAKGEIPEVAFM 617
|
Involved in the nuclear export of mRNA species bearing retroviral constitutive transport elements (CTE) and in the export of mRNA from the nucleus to the cytoplasm. The NXF1-NXT1 heterodimer is involved in the export of HSP70 mRNA in conjunction with ALYREF/THOC4 and THOC5. Rattus norvegicus (taxid: 10116) |
| >sp|Q99JX7|NXF1_MOUSE Nuclear RNA export factor 1 OS=Mus musculus GN=Nxf1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q9UBU9|NXF1_HUMAN Nuclear RNA export factor 1 OS=Homo sapiens GN=NXF1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P58797|NXF1_COTJA Nuclear RNA export factor 1 OS=Coturnix coturnix japonica GN=NXF1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q1RMS5|NXF1_BOVIN Nuclear RNA export factor 1 OS=Bos taurus GN=NXF1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5R752|NXF1_PONAB Nuclear RNA export factor 1 OS=Pongo abelii GN=NXF1 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9U1H9|NXF1_DROME Nuclear RNA export factor 1 OS=Drosophila melanogaster GN=sbr PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9GZY0|NXF2_HUMAN Nuclear RNA export factor 2 OS=Homo sapiens GN=NXF2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9XVS7|NXF1_CAEEL Nuclear RNA export factor 1 OS=Caenorhabditis elegans GN=nxf-1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9Y8G3|MEX67_SCHPO mRNA export factor mex67 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mex67 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 442 | ||||||
| 357603430 | 606 | hypothetical protein KGM_03155 [Danaus p | 0.963 | 0.702 | 0.413 | 1e-91 | |
| 91089011 | 607 | PREDICTED: similar to small bristles CG1 | 0.986 | 0.718 | 0.401 | 4e-89 | |
| 242010126 | 623 | Nuclear RNA export factor, putative [Ped | 0.977 | 0.693 | 0.395 | 1e-84 | |
| 312382723 | 668 | hypothetical protein AND_04406 [Anophele | 0.954 | 0.631 | 0.394 | 2e-84 | |
| 321454884 | 633 | hypothetical protein DAPPUDRAFT_332592 [ | 0.979 | 0.684 | 0.396 | 8e-84 | |
| 321455099 | 627 | hypothetical protein DAPPUDRAFT_302769 [ | 0.979 | 0.690 | 0.396 | 9e-84 | |
| 345478812 | 640 | PREDICTED: LOW QUALITY PROTEIN: nuclear | 0.979 | 0.676 | 0.395 | 2e-81 | |
| 25742576 | 618 | nuclear RNA export factor 1 [Rattus norv | 0.961 | 0.687 | 0.386 | 2e-80 | |
| 344295980 | 617 | PREDICTED: nuclear RNA export factor 1 [ | 0.970 | 0.695 | 0.375 | 3e-80 | |
| 189534068 | 642 | PREDICTED: nuclear RNA export factor 1 [ | 0.979 | 0.674 | 0.374 | 6e-79 |
| >gi|357603430|gb|EHJ63760.1| hypothetical protein KGM_03155 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
Score = 343 bits (880), Expect = 1e-91, Method: Compositional matrix adjust.
Identities = 184/445 (41%), Positives = 282/445 (63%), Gaps = 19/445 (4%)
Query: 10 LIVLVSSATPYVELNNEIKDKIKLVMAKRYNGDNKALDLSKFYADPDFVEANMFVPLDRS 69
L++LV ++ P V ++ ++K+K+KLVMAKRYN KALDL+KF+ADPD + +F L R
Sbjct: 168 LLILVRNSVPNVNIDADMKEKMKLVMAKRYNAATKALDLTKFHADPDLTD--IFCALFRP 225
Query: 70 NVMTSVCNIINENLPDLFALNLSENKLYYPESLISLAKVIPRVKILYLAHNNIKDLATIR 129
+M+ +I+ +N+PDL ALNL+ENK++ E + L + +KILYL N I LA +
Sbjct: 226 IIMSVAIDIMADNIPDLEALNLNENKIHGMEHMKVLCTKLKNLKILYLGDNRITTLAALE 285
Query: 130 TLESLSNLEELRLEKNPWTECFNEQDAYTSEVRKIFPKLLKLDDIQLPPPIVFDLEDNIE 189
L+ L L EL L+ NP FN+ D Y S+VRK FPKL++LD + LPP I FD+ +++
Sbjct: 286 PLKPLP-LVELYLKGNPLVSRFNDHDIYVSDVRKKFPKLIRLDGVDLPPAIGFDVSEDLS 344
Query: 190 LPKPQGSFLCHPEARDILRAFLEQYFALFDTESRAGLIDAYHENAQYSLVVT--QGLGNN 247
LP Q SFL P ++++R FL QYFA++D++SR L++AYHE A S+ G N
Sbjct: 345 LPSRQQSFLIDPAGQNLVREFLTQYFAIYDSDSRQPLLEAYHETATMSMAAGYLSNEGRN 404
Query: 248 ---HLLNNMLANSRNLLRIEEPQRQKSLLSVGKADILRALRFLPATKHDLLSFTCDCPLY 304
+ LN ++NSRN++RI + + ++ L G+ ++ L LP T HDL+ F D ++
Sbjct: 405 VPGNKLNAYISNSRNIMRITDRESRRRYLRTGRLQVVSFLSDLPKTNHDLMGFAVDLLVF 464
Query: 305 TPGLIQFSVCGLYEEITTGTKNKSKLIRAFNRAFLLVPRSGGGFAITNDQLFITSATPEQ 364
TP +I ++ G+Y E TT N + R+F+R F+++P + GGF+ITND LF+++ T EQ
Sbjct: 465 TPAMIVLTMNGVYRE-TTAYGNPT---RSFHRTFVIIPNATGGFSITNDMLFVSNTTKEQ 520
Query: 365 AEKAFS-SQVTASESTCSTPVSNEILI------KQNMVKALSQVSGMNLNFSEKCLNEVQ 417
+K+FS +V S ST + PV+ ++ M+ L Q +GMN ++S CL E
Sbjct: 521 EDKSFSGGEVAPSSSTSAPPVATLAATPSYDENQRMMLNMLCQQTGMNEHWSVNCLQETG 580
Query: 418 WDYDQAVTIFNQLKAKNALPSEAFI 442
WDY +A+ IFNQL+++ +P +AF+
Sbjct: 581 WDYQRALFIFNQLQSEGKIPPDAFV 605
|
Source: Danaus plexippus Species: Danaus plexippus Genus: Danaus Family: Nymphalidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|91089011|ref|XP_968226.1| PREDICTED: similar to small bristles CG1664-PA [Tribolium castaneum] gi|270011540|gb|EFA07988.1| hypothetical protein TcasGA2_TC005575 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242010126|ref|XP_002425827.1| Nuclear RNA export factor, putative [Pediculus humanus corporis] gi|212509760|gb|EEB13089.1| Nuclear RNA export factor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|312382723|gb|EFR28081.1| hypothetical protein AND_04406 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|321454884|gb|EFX66035.1| hypothetical protein DAPPUDRAFT_332592 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|321455099|gb|EFX66242.1| hypothetical protein DAPPUDRAFT_302769 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|345478812|ref|XP_001599027.2| PREDICTED: LOW QUALITY PROTEIN: nuclear RNA export factor 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|25742576|ref|NP_067590.1| nuclear RNA export factor 1 [Rattus norvegicus] gi|20455167|sp|O88984.1|NXF1_RAT RecName: Full=Nuclear RNA export factor 1; AltName: Full=Tip-associated protein; AltName: Full=Tip-associating protein; AltName: Full=mRNA export factor TAP gi|3719433|gb|AAC63367.1| tip associating protein [Rattus norvegicus] | Back alignment and taxonomy information |
|---|
| >gi|344295980|ref|XP_003419688.1| PREDICTED: nuclear RNA export factor 1 [Loxodonta africana] | Back alignment and taxonomy information |
|---|
| >gi|189534068|ref|XP_001923961.1| PREDICTED: nuclear RNA export factor 1 [Danio rerio] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 442 | ||||||
| ZFIN|ZDB-GENE-030131-2585 | 642 | nxf1 "nuclear RNA export facto | 0.984 | 0.677 | 0.356 | 6.7e-72 | |
| RGD|62014 | 618 | Nxf1 "nuclear RNA export facto | 0.959 | 0.686 | 0.372 | 1.1e-71 | |
| UNIPROTKB|O88984 | 618 | Nxf1 "Nuclear RNA export facto | 0.959 | 0.686 | 0.372 | 1.1e-71 | |
| MGI|MGI:1858330 | 618 | Nxf1 "nuclear RNA export facto | 0.981 | 0.702 | 0.358 | 9.9e-71 | |
| UNIPROTKB|J9NV67 | 623 | NXF1 "Uncharacterized protein" | 0.970 | 0.688 | 0.359 | 1.6e-70 | |
| UNIPROTKB|Q1RMS5 | 620 | NXF1 "Nuclear RNA export facto | 0.970 | 0.691 | 0.361 | 2.1e-70 | |
| UNIPROTKB|Q9UBU9 | 619 | NXF1 "Nuclear RNA export facto | 0.959 | 0.684 | 0.367 | 4.3e-70 | |
| UNIPROTKB|I3LNX4 | 620 | NXF1 "Uncharacterized protein" | 0.970 | 0.691 | 0.359 | 5.5e-70 | |
| UNIPROTKB|E2QVI8 | 625 | NXF1 "Uncharacterized protein" | 0.970 | 0.686 | 0.354 | 2.1e-68 | |
| UNIPROTKB|F6XRT0 | 623 | NXF1 "Uncharacterized protein" | 0.947 | 0.672 | 0.358 | 3.5e-68 |
| ZFIN|ZDB-GENE-030131-2585 nxf1 "nuclear RNA export factor 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 727 (261.0 bits), Expect = 6.7e-72, P = 6.7e-72
Identities = 160/449 (35%), Positives = 251/449 (55%)
Query: 1 RIKTVTNHTLIVLVSSATPYVELNNEIK----DKIKLVMAKRYNGDNKALDLSKFYADPD 56
RI + + V+++S P +++++K + +K MAKR++G +ALDL+ DPD
Sbjct: 200 RITDKDGYKVAVIMNSCPPPTLIHSDLKPADLEHLKQCMAKRFDGSQQALDLNNIRVDPD 259
Query: 57 FVEANMFVPLDRSNVMTSVCNIINENLPDLFALNLSENKLYYPESLISLAKVIPRVKILY 116
V N+ V L+R N M +V II EN+P+L LNLS N+L+ + L+ + +P +KIL
Sbjct: 260 LVSQNIEVTLNRKNSMCAVIKIIEENIPELVCLNLSNNRLFRLDDLVDIIHKVPNLKILN 319
Query: 117 LAHNNIKDLATIRTXXXXXXXXXXXXXKNPWTECFNEQDAYTSEVRKIFPKLLKLDDIQL 176
L+HN +K + NP F Y S +R+ FPKLLKLD L
Sbjct: 320 LSHNELKTERELDKLKGLKLVDLSLEG-NPLCHHFKIHADYISAIRERFPKLLKLDGHDL 378
Query: 177 PPPIVFDLEDNIE-LPKPQGSFLCHPEARDILRAFLEQYFALFDTESRAGLIDAYHENAQ 235
PPPI FDL+D LP + S+ C E ++I+ FL+Q++ ++D+ +R L+DAYH+ A
Sbjct: 379 PPPIGFDLDDGPSTLPPSKASYFCSEEIKNIILCFLQQFYNVYDSGNRQPLLDAYHDGAT 438
Query: 236 YSLVV--TQGXXXXXXXXXXXXXSRNLLRIEEPQRQKSLLSVGKADILRALRFLPATKHD 293
+SL + SRN+ R+++P + L+ + +++ L LP T+HD
Sbjct: 439 FSLSIPFVSLNPSKSTLGEYQKDSRNIKRMKDPTTRYRLIKHTRLNVVAFLNELPKTQHD 498
Query: 294 LLSFTCDCPLYTPGLIQFSVCGLYEEITTGTKNKSKLIRAFNRAFLLVPRSGGGFAITND 353
+ SF D YT L+ F+VCG+++E+ G ++ RAF+R F+ VP G I ND
Sbjct: 499 IASFVVDVNTYTATLLAFTVCGVFKEMD-GKSRET--YRAFSRVFIAVPAGSTGLCIVND 555
Query: 354 QLFITSATPEQAEKAFSSQVTASESTCSTPVSNEILIKQNMVKALSQVSGMNLNFSEKCL 413
+LF+ +AT E+ +AF V + + S+PV +Q M+ A S SGMNL +S+KCL
Sbjct: 556 ELFVRNATTEEIRRAF---VAPAPTPSSSPVPTLSAHQQEMLAAFSLKSGMNLEWSQKCL 612
Query: 414 NEVQWDYDQAVTIFNQLKAKNALPSEAFI 442
+ WD+++A IF LKA+ +P AF+
Sbjct: 613 QDNDWDFERAAQIFTGLKAQGKIPDVAFV 641
|
|
| RGD|62014 Nxf1 "nuclear RNA export factor 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O88984 Nxf1 "Nuclear RNA export factor 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1858330 Nxf1 "nuclear RNA export factor 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NV67 NXF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q1RMS5 NXF1 "Nuclear RNA export factor 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UBU9 NXF1 "Nuclear RNA export factor 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LNX4 NXF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QVI8 NXF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6XRT0 NXF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q5R752 | NXF1_PONAB | No assigned EC number | 0.3662 | 0.9592 | 0.6773 | yes | N/A |
| O88984 | NXF1_RAT | No assigned EC number | 0.3867 | 0.9615 | 0.6877 | yes | N/A |
| Q9UBU9 | NXF1_HUMAN | No assigned EC number | 0.3767 | 0.9592 | 0.6849 | yes | N/A |
| Q9XVS7 | NXF1_CAEEL | No assigned EC number | 0.3123 | 0.9321 | 0.6560 | yes | N/A |
| Q1RMS5 | NXF1_BOVIN | No assigned EC number | 0.3806 | 0.9366 | 0.6677 | yes | N/A |
| Q9U1H9 | NXF1_DROME | No assigned EC number | 0.3413 | 0.9751 | 0.6413 | yes | N/A |
| Q99JX7 | NXF1_MOUSE | No assigned EC number | 0.3616 | 0.9841 | 0.7038 | yes | N/A |
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 5.3.3.1 | LOW CONFIDENCE prediction! |
| 3rd Layer | 5.3.3 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 442 | |||
| smart00804 | 63 | smart00804, TAP_C, C-terminal domain of vertebrate | 4e-17 | |
| pfam03943 | 51 | pfam03943, TAP_C, TAP C-terminal domain | 6e-14 | |
| cd00780 | 119 | cd00780, NTF2, Nuclear transport factor 2 (NTF2) d | 4e-13 | |
| cd00531 | 124 | cd00531, NTF2_like, Nuclear transport factor 2 (NT | 4e-09 | |
| pfam02136 | 116 | pfam02136, NTF2, Nuclear transport factor 2 (NTF2) | 6e-06 |
| >gnl|CDD|197882 smart00804, TAP_C, C-terminal domain of vertebrate Tap protein | Back alignment and domain information |
|---|
Score = 75.0 bits (185), Expect = 4e-17
Identities = 22/53 (41%), Positives = 36/53 (67%)
Query: 390 IKQNMVKALSQVSGMNLNFSEKCLNEVQWDYDQAVTIFNQLKAKNALPSEAFI 442
+Q MV+A S +GMN +S+ CL + WDY++A+ F +LK++ ++P EAF
Sbjct: 11 EQQEMVQAFSAQTGMNAEYSQMCLEDNNWDYERALKNFTELKSEGSIPPEAFA 63
|
The vertebrate Tap protein is a member of the NXF family of shuttling transport receptors for the nuclear export of mRNA. Its most C-terminal domain is important for binding to FG repeat-containing nuclear pore proteins (FG-nucleoporins) and is sufficient to mediate shuttling. This domain forms a compact four-helix fold related to that of a UBA domain. Length = 63 |
| >gnl|CDD|112742 pfam03943, TAP_C, TAP C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|238403 cd00780, NTF2, Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus | Back alignment and domain information |
|---|
| >gnl|CDD|238296 cd00531, NTF2_like, Nuclear transport factor 2 (NTF2-like) superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|216894 pfam02136, NTF2, Nuclear transport factor 2 (NTF2) domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 442 | |||
| KOG3763|consensus | 585 | 100.0 | ||
| smart00804 | 63 | TAP_C C-terminal domain of vertebrate Tap protein. | 99.9 | |
| PF03943 | 51 | TAP_C: TAP C-terminal domain; InterPro: IPR005637 | 99.89 | |
| KOG2104|consensus | 126 | 99.87 | ||
| cd00780 | 119 | NTF2 Nuclear transport factor 2 (NTF2) domain play | 99.84 | |
| PF02136 | 118 | NTF2: Nuclear transport factor 2 (NTF2) domain; In | 99.77 | |
| KOG4353|consensus | 139 | 99.55 | ||
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.53 | |
| KOG2123|consensus | 388 | 99.37 | ||
| KOG1644|consensus | 233 | 99.22 | ||
| KOG0116|consensus | 419 | 99.1 | ||
| KOG2739|consensus | 260 | 98.84 | ||
| KOG1259|consensus | 490 | 98.62 | ||
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.41 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.36 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.24 | |
| KOG2982|consensus | 418 | 98.21 | ||
| cd00531 | 124 | NTF2_like Nuclear transport factor 2 (NTF2-like) s | 98.15 | |
| PF14555 | 43 | UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A | 98.15 | |
| KOG1859|consensus | 1096 | 98.13 | ||
| KOG3207|consensus | 505 | 97.96 | ||
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.85 | |
| KOG3207|consensus | 505 | 97.64 | ||
| KOG0472|consensus | 565 | 97.37 | ||
| KOG1644|consensus | 233 | 97.36 | ||
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.34 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.32 | |
| KOG0531|consensus | 414 | 97.29 | ||
| KOG1259|consensus | 490 | 97.23 | ||
| KOG4194|consensus | 873 | 97.21 | ||
| KOG3665|consensus | 699 | 97.19 | ||
| KOG4579|consensus | 177 | 97.14 | ||
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.1 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.04 | |
| KOG0618|consensus | 1081 | 96.99 | ||
| KOG1859|consensus | 1096 | 96.74 | ||
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 96.68 | |
| PF10429 | 166 | Mtr2: Nuclear pore RNA shuttling protein Mtr2; Int | 96.63 | |
| KOG4194|consensus | 873 | 96.63 | ||
| KOG0617|consensus | 264 | 96.55 | ||
| KOG2982|consensus | 418 | 96.55 | ||
| KOG0444|consensus | 1255 | 96.51 | ||
| KOG0531|consensus | 414 | 96.46 | ||
| TIGR02246 | 128 | conserved hypothetical protein. This family consis | 96.22 | |
| KOG0444|consensus | 1255 | 96.14 | ||
| KOG0618|consensus | 1081 | 96.12 | ||
| KOG4237|consensus | 498 | 96.07 | ||
| PLN03150 | 623 | hypothetical protein; Provisional | 96.06 | |
| PF13474 | 121 | SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE | 96.04 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 95.99 | |
| KOG4237|consensus | 498 | 95.94 | ||
| PLN03150 | 623 | hypothetical protein; Provisional | 95.82 | |
| KOG2739|consensus | 260 | 95.82 | ||
| KOG3665|consensus | 699 | 95.81 | ||
| KOG0617|consensus | 264 | 95.7 | ||
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 95.68 | |
| KOG2123|consensus | 388 | 95.5 | ||
| KOG1909|consensus | 382 | 95.33 | ||
| KOG0472|consensus | 565 | 95.19 | ||
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 95.01 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 94.91 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 93.57 | |
| PF15008 | 262 | DUF4518: Domain of unknown function (DUF4518) | 93.54 | |
| KOG4579|consensus | 177 | 93.24 | ||
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 93.23 | |
| PF00627 | 37 | UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma | 92.42 | |
| smart00365 | 26 | LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | 92.39 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 92.14 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 91.78 | |
| KOG3864|consensus | 221 | 90.97 | ||
| KOG1909|consensus | 382 | 90.58 | ||
| smart00446 | 26 | LRRcap occurring C-terminal to leucine-rich repeat | 90.39 | |
| KOG2120|consensus | 419 | 90.31 | ||
| smart00165 | 37 | UBA Ubiquitin associated domain. Present in Rad23, | 90.09 | |
| PF13577 | 127 | SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RF | 89.99 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 89.95 | |
| PF14534 | 107 | DUF4440: Domain of unknown function (DUF4440); PDB | 88.64 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 88.27 | |
| cd00194 | 38 | UBA Ubiquitin Associated domain. The UBA domain is | 87.87 | |
| PF12680 | 102 | SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8 | 87.76 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 87.57 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 87.57 | |
| KOG2120|consensus | 419 | 87.3 | ||
| smart00365 | 26 | LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | 87.01 | |
| KOG0532|consensus | 722 | 86.14 | ||
| KOG1947|consensus | 482 | 85.84 | ||
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 84.74 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 83.79 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 83.79 | |
| KOG3864|consensus | 221 | 81.0 | ||
| PF02845 | 42 | CUE: CUE domain; InterPro: IPR003892 This domain m | 80.86 |
| >KOG3763|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.7e-97 Score=750.95 Aligned_cols=435 Identities=34% Similarity=0.602 Sum_probs=401.9
Q ss_pred CcccCCCCEEEEEEeC-CCCCc---cCCHHHHHHHHHHHhhcCCcccceEeCCCCCCCccccccCccccCCchhHHHHHH
Q psy1142 1 RIKTVTNHTLIVLVSS-ATPYV---ELNNEIKDKIKLVMAKRYNGDNKALDLSKFYADPDFVEANMFVPLDRSNVMTSVC 76 (442)
Q Consensus 1 ~i~~~~~~k~~i~v~~-~~P~~---~~~~~~~~~l~~~l~~ry~~~~~~LdLs~l~~dp~L~~~~i~~~ln~~~~~~~~l 76 (442)
+|.++.+.++.|++.+ .+|.+ +++++++|.|+.+|.+||+++++.|||++|+.||+|+..|+++.++++++|.+++
T Consensus 131 r~~~~~n~~~~i~~~~sn~~~~~~~~lkpe~IE~l~~v~~kRyd~~~~~LDL~nl~~DPel~~~di~~~l~~rn~M~~~L 210 (585)
T KOG3763|consen 131 RIVDEENSSISIFVNPSNIPASVHNKLKPEEIEILKLVMNKRYDVSQQALDLQNLRFDPELVNRDILMVLNKRNCMAAVL 210 (585)
T ss_pred hhccccCcceeEEeccCCCCchhhcccCHHHHHHHHHHHhccccHHHhhhhhhccccChhhhhccchhhcccchhhHHHH
Confidence 5788999999999999 88888 9999999999999999999999999999999999999999999999999999999
Q ss_pred HHHhcCCCCccEEeCCCCCCCCCCCchhhhhccCCCcEEEcCCC--CCCCchhhhhcCCCCCCCeEEecCCCCCCcCCCc
Q psy1142 77 NIINENLPDLFALNLSENKLYYPESLISLAKVIPRVKILYLAHN--NIKDLATIRTLESLSNLEELRLEKNPWTECFNEQ 154 (442)
Q Consensus 77 ~i~~~~~~~L~~L~Ls~N~l~~l~~l~~l~~~~p~L~~L~Ls~N--~I~~~~~L~~l~~l~~L~eL~L~gNPl~~~~~~~ 154 (442)
+++.+++|.+.+|+||+|+|++|+.+++|++.+|+|++|+||+| .|.+..|+.+++++ +|+||+|+|||||++|.+.
T Consensus 211 ~~~~~n~p~i~sl~lsnNrL~~Ld~~sslsq~apklk~L~LS~N~~~~~~~~el~K~k~l-~Leel~l~GNPlc~tf~~~ 289 (585)
T KOG3763|consen 211 KHIEENFPEILSLSLSNNRLYHLDALSSLSQIAPKLKTLDLSHNHSKISSESELDKLKGL-PLEELVLEGNPLCTTFSDR 289 (585)
T ss_pred HHhhcCCcceeeeecccchhhchhhhhHHHHhcchhheeecccchhhhcchhhhhhhcCC-CHHHeeecCCccccchhhh
Confidence 99999999999999999999999999999999999999999999 99999999999999 9999999999999999999
Q ss_pred hhhHHHHHhhCCcccccCCccCCCcccccccCCCCCCCCCCCCcCChhhHHHHHHHHHHHhhcccccChhhHHhccccCc
Q psy1142 155 DAYTSEVRKIFPKLLKLDDIQLPPPIVFDLEDNIELPKPQGSFLCHPEARDILRAFLEQYFALFDTESRAGLIDAYHENA 234 (442)
Q Consensus 155 ~~y~~~i~~~fP~L~~LDg~~v~~~~~~~~~~~~~~P~~~~~f~~~~~~~~~~~~Fl~~yf~~~D~~~R~~L~~~Y~~~a 234 (442)
..|++.|++.||+|.+|||++|++++. |++...++++++++|||+++++++|++|+++||.+||+++|+.+..+||++|
T Consensus 290 s~yv~~i~~~FPKL~~LDG~ev~~~~~-d~~~~~~~~p~k~~ff~~~~l~~LV~~Fl~~y~~~yD~~d~q~~~~~y~dns 368 (585)
T KOG3763|consen 290 SEYVSAIRELFPKLLRLDGVEVQPEVI-DINASETPMPCKQNFFGSEELKQLVLQFLQQYYKIYDNNDGQLLLYAYHDNS 368 (585)
T ss_pred HHHHHHHHHhcchheeecCcccCcccc-ccccccCCcchhhcccCchHHHHHHHHHHHHHHHhhcCchhhhHHhhcCccc
Confidence 999999999999999999999998776 7777677777999999999999999999999999999988888999999999
Q ss_pred eEEEEeecCCCC---C-cchhhhcccCcccccCCChhhhhhhhccCHHHHHHHHHhCCCCccCCCCeeeeecCCCCCeEE
Q psy1142 235 QYSLVVTQGLGN---N-HLLNNMLANSRNLLRIEEPQRQKSLLSVGKADILRALRFLPATKHDLLSFTCDCPLYTPGLIQ 310 (442)
Q Consensus 235 ~fSls~~~~~~~---~-~~~~~Y~~~sRNl~~~~~~~~r~~~l~~G~~~I~~~l~~LP~t~H~~~sf~vD~~~~~~~~l~ 310 (442)
|||+|+++.+.+ + +.|+.|+++|||+++++++..|.+++++|+++|+..|+.||+|+||+++|+||+|.++..+++
T Consensus 369 ~FSlsi~~~~~~s~~~~~~~~~Y~k~SRNi~~l~~~~~r~srl~~g~~~Iv~aLs~LPkT~Hdl~s~vvDv~~~~~~~l~ 448 (585)
T KOG3763|consen 369 TFSLTINFLPVPSHPDPSSLGKYFKDSRNILKLKDPYLRASRLKHGACDIVVALSALPKTQHDLDSFVVDVWYQTGNLLG 448 (585)
T ss_pred eeEEEecccCCCCCCchHHHHHHHhhcchhhhhcCHHHHHHhhhccchHHHHHHHhCccchhhhhhhheeeeecccceEE
Confidence 999999998433 1 789999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEeeeEEEecCCCCCCCCCeee---EEEEEEEEeCCCCceEEEcceeEeecCChhHHhhhhccccCCCCCCCCCCCc--
Q psy1142 311 FSVCGLYEEITTGTKNKSKLIRA---FNRAFLLVPRSGGGFAITNDQLFITSATPEQAEKAFSSQVTASESTCSTPVS-- 385 (442)
Q Consensus 311 i~V~G~f~e~~~~~~~~~~~~r~---F~RtFvl~p~~~~~~~I~ND~l~ir~~s~~~~~~~~~~~~~~p~~~~~~p~~-- 385 (442)
|+|||.|+|. +| .+ ....++ |+|||+++|.+++|.+|+||+|+|+..+....+.++..++|++.+++ +|..
T Consensus 449 ftv~G~f~d~-~g-~~-~~s~~~~~~FtRtfvv~P~~ns~l~iv~d~Lfi~~~s~~~~~~~~~~~~~ta~ss~-~P~~s~ 524 (585)
T KOG3763|consen 449 FTVAGVFRDG-EG-QN-SPSNRALLGFTRTFVVTPRENSGLAIVNDQLFIASASLHRTQPSKALIVPTAFSSS-VPQPSE 524 (585)
T ss_pred EEEEEEeecC-Cc-cC-CcccccccccceEEEEeeCCCCceEEEeceeEEeeccccccccccccccccccccC-CCCCcc
Confidence 9999999987 56 33 456566 99999999999889999999999999999888877777766544443 4432
Q ss_pred -----hhhHHHHHHHHHHHHHhCCCHHHHHHHHHhcCCCHHHHHHHHHhhhhcCCCCcccc
Q psy1142 386 -----NEILIKQNMVKALSQVSGMNLNFSEKCLNEVQWDYDQAVTIFNQLKAKNALPSEAF 441 (442)
Q Consensus 386 -----~~~~~q~~mv~~~~~~Tgmn~~~s~~cL~~~~Wd~~~A~~~F~~l~~~~~iP~eAF 441 (442)
.+....++|+.+|+++||||.+||+||||||+|||++|++.|.++|+.+.||++||
T Consensus 525 ~qq~~~~~~~~~e~l~~~~~~tGln~~~s~~c~e~~nWdy~~A~k~F~~~ks~~~ipa~Af 585 (585)
T KOG3763|consen 525 EQQEELSVDVTDEKLLKFQEETGLNSEWSTMCLEQNNWDYERALKLFIELKSDHPIPAFAF 585 (585)
T ss_pred ccchhcccchHHHHHHHHHHHhcCChHHHHHHHHHccCCHHHHHHHHHHhhcCCCCccccC
Confidence 01112377899999999999999999999999999999999999999999999998
|
|
| >smart00804 TAP_C C-terminal domain of vertebrate Tap protein | Back alignment and domain information |
|---|
| >PF03943 TAP_C: TAP C-terminal domain; InterPro: IPR005637 This entry contains the NXF family of shuttling transport receptors for nuclear export of mRNA, which include: vertebrate mRNA export factor TAP or nuclear RNA export factor 1 (NXF1) | Back alignment and domain information |
|---|
| >KOG2104|consensus | Back alignment and domain information |
|---|
| >cd00780 NTF2 Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus | Back alignment and domain information |
|---|
| >PF02136 NTF2: Nuclear transport factor 2 (NTF2) domain; InterPro: IPR002075 Nuclear transport factor 2 (NTF2) is a homodimer which stimulates efficient nuclear import of a cargo protein | Back alignment and domain information |
|---|
| >KOG4353|consensus | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG2123|consensus | Back alignment and domain information |
|---|
| >KOG1644|consensus | Back alignment and domain information |
|---|
| >KOG0116|consensus | Back alignment and domain information |
|---|
| >KOG2739|consensus | Back alignment and domain information |
|---|
| >KOG1259|consensus | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG2982|consensus | Back alignment and domain information |
|---|
| >cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily | Back alignment and domain information |
|---|
| >PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A | Back alignment and domain information |
|---|
| >KOG1859|consensus | Back alignment and domain information |
|---|
| >KOG3207|consensus | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG3207|consensus | Back alignment and domain information |
|---|
| >KOG0472|consensus | Back alignment and domain information |
|---|
| >KOG1644|consensus | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0531|consensus | Back alignment and domain information |
|---|
| >KOG1259|consensus | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >KOG3665|consensus | Back alignment and domain information |
|---|
| >KOG4579|consensus | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0618|consensus | Back alignment and domain information |
|---|
| >KOG1859|consensus | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF10429 Mtr2: Nuclear pore RNA shuttling protein Mtr2; InterPro: IPR019488 Mtr2 is a monomeric, dual-action, RNA-shuttle protein found in yeasts | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >KOG0617|consensus | Back alignment and domain information |
|---|
| >KOG2982|consensus | Back alignment and domain information |
|---|
| >KOG0444|consensus | Back alignment and domain information |
|---|
| >KOG0531|consensus | Back alignment and domain information |
|---|
| >TIGR02246 conserved hypothetical protein | Back alignment and domain information |
|---|
| >KOG0444|consensus | Back alignment and domain information |
|---|
| >KOG0618|consensus | Back alignment and domain information |
|---|
| >KOG4237|consensus | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4237|consensus | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2739|consensus | Back alignment and domain information |
|---|
| >KOG3665|consensus | Back alignment and domain information |
|---|
| >KOG0617|consensus | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG2123|consensus | Back alignment and domain information |
|---|
| >KOG1909|consensus | Back alignment and domain information |
|---|
| >KOG0472|consensus | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PF15008 DUF4518: Domain of unknown function (DUF4518) | Back alignment and domain information |
|---|
| >KOG4579|consensus | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] | Back alignment and domain information |
|---|
| >smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG3864|consensus | Back alignment and domain information |
|---|
| >KOG1909|consensus | Back alignment and domain information |
|---|
| >smart00446 LRRcap occurring C-terminal to leucine-rich repeats | Back alignment and domain information |
|---|
| >KOG2120|consensus | Back alignment and domain information |
|---|
| >smart00165 UBA Ubiquitin associated domain | Back alignment and domain information |
|---|
| >PF13577 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RFR_A 3B8L_F 2CHC_A 3A76_A 3EF8_B | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >cd00194 UBA Ubiquitin Associated domain | Back alignment and domain information |
|---|
| >PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >KOG2120|consensus | Back alignment and domain information |
|---|
| >smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | Back alignment and domain information |
|---|
| >KOG0532|consensus | Back alignment and domain information |
|---|
| >KOG1947|consensus | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >KOG3864|consensus | Back alignment and domain information |
|---|
| >PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 442 | ||||
| 1jkg_B | 250 | Structural Basis For The Recognition Of A Nucleopor | 9e-38 | ||
| 1koh_A | 277 | The Crystal Structure And Mutational Analysis Of A | 5e-30 | ||
| 1koo_A | 277 | The Crystal Structure And Mutational Analysis Of A | 1e-29 | ||
| 1fo1_A | 271 | Crystal Structure Of The Rna-Binding Domain Of The | 4e-29 | ||
| 1ft8_A | 271 | Crystal Structure Of The Rna-Binding Domain Of The | 4e-29 | ||
| 3rw6_A | 267 | Structure Of Nuclear Rna Export Factor Tap Bound To | 7e-28 | ||
| 3nv0_A | 205 | Crystal Structure And Mutational Analysis Of The Nx | 5e-10 | ||
| 1go5_A | 69 | Structure Of The C-Terminal Fg-Binding Domain Of Hu | 8e-09 | ||
| 1oai_A | 59 | Complex Between Tap Uba Domain And Fxfg Nucleoporin | 4e-08 | ||
| 1q40_B | 219 | Crystal Structure Of The C. Albicans Mtr2-Mex67 M D | 4e-06 |
| >pdb|1JKG|B Chain B, Structural Basis For The Recognition Of A Nucleoporin Fg- Repeat By The Ntf2-Like Domain Of Tap-P15 Mrna Nuclear Export Factor Length = 250 | Back alignment and structure |
|
| >pdb|1KOH|A Chain A, The Crystal Structure And Mutational Analysis Of A Novel Rna-Binding Domain Found In The Human Tap Nuclear Mrna Export Factor Length = 277 | Back alignment and structure |
| >pdb|1KOO|A Chain A, The Crystal Structure And Mutational Analysis Of A Novel Rna-Binding Domain Found In The Human Tap Nuclear Mrna Export Factor Length = 277 | Back alignment and structure |
| >pdb|1FO1|A Chain A, Crystal Structure Of The Rna-Binding Domain Of The Mrna Export Factor Tap Length = 271 | Back alignment and structure |
| >pdb|1FT8|A Chain A, Crystal Structure Of The Rna-Binding Domain Of The Mrna Export Factor Tap Length = 271 | Back alignment and structure |
| >pdb|3RW6|A Chain A, Structure Of Nuclear Rna Export Factor Tap Bound To Cte Rna Length = 267 | Back alignment and structure |
| >pdb|3NV0|A Chain A, Crystal Structure And Mutational Analysis Of The Nxf2NXT1 Heterodimeric Complex From Caenorhabditis Elegans At 1.84 A Resolution Length = 205 | Back alignment and structure |
| >pdb|1GO5|A Chain A, Structure Of The C-Terminal Fg-Binding Domain Of Human Tap Length = 69 | Back alignment and structure |
| >pdb|1OAI|A Chain A, Complex Between Tap Uba Domain And Fxfg Nucleoporin Peptide Length = 59 | Back alignment and structure |
| >pdb|1Q40|B Chain B, Crystal Structure Of The C. Albicans Mtr2-Mex67 M Domain Complex Length = 219 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A Length = 250 | Back alignment and structure |
|---|
Score = 239 bits (611), Expect = 4e-77
Identities = 88/254 (34%), Positives = 143/254 (56%), Gaps = 8/254 (3%)
Query: 191 PKPQGSFLCHPEARDILRAFLEQYFALFDTESRAGLIDAYHENAQYSLVVTQGLGNNHL- 249
P +GS+ + ++ FL+QY+A++D+ R GL+DAYH+ A SL + N
Sbjct: 2 PPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIPQNPARS 61
Query: 250 -LNNMLANSRNLLRIEEPQRQKSLLSVGKADILRALRFLPATKHDLLSFTCDCPLYTPGL 308
L +SRN+ ++++P + LL + +++ L LP T+HD+ SF D T L
Sbjct: 62 SLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTL 121
Query: 309 IQFSVCGLYEEITTGTKNKSKLIRAFNRAFLLVPRSGGGFAITNDQLFITSATPEQAEKA 368
+ FSV G+++E+ +++ +RAF R F+ VP S G I ND+LF+ +A+ E+ ++A
Sbjct: 122 LCFSVNGVFKEVDGKSRD---SLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRA 178
Query: 369 FSSQVTASESTCSTPVSNEILIKQNMVKALSQVSGMNLNFSEKCLNEVQWDYDQAVTIFN 428
F+ S+ PV +Q M++A S SGMNL +S+KCL + WDY ++ F
Sbjct: 179 FAMPAPTPSSS---PVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFT 235
Query: 429 QLKAKNALPSEAFI 442
LKAK +P AF+
Sbjct: 236 HLKAKGEIPEVAFM 249
|
| >3nv0_A Nuclear RNA export factor 2; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Length = 205 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 | Back alignment and structure |
|---|
| >1q40_B MEX67, mRNA export factor MEX67; NTF2-fold, nuclear export, translation; 1.95A {Candida albicans} SCOP: d.17.4.2 Length = 219 | Back alignment and structure |
|---|
| >1of5_A MRNA export factor MEX67; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 Length = 221 | Back alignment and structure |
|---|
| >1oai_A Nuclear RNA export factor; nuclear transport, nuclear transport factor; 1.0A {Homo sapiens} SCOP: a.5.2.3 Length = 59 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >2jp7_A MRNA export factor MEX67; solution MEX67, UBA, translation; NMR {Saccharomyces cerevisiae} PDB: 2khh_A Length = 57 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Length = 154 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A Length = 154 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A Length = 127 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A Length = 125 | Back alignment and structure |
|---|
| >3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} Length = 120 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 Length = 129 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A Length = 140 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 | Back alignment and structure |
|---|
| >3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} Length = 140 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 442 | |||
| 1jkg_B | 250 | TAP; NTF2-like domain, transport protein; 1.90A {H | 100.0 | |
| 3nv0_A | 205 | Nuclear RNA export factor 2; NTF2-like domain, bet | 100.0 | |
| 1q40_B | 219 | MEX67, mRNA export factor MEX67; NTF2-fold, nuclea | 100.0 | |
| 1of5_A | 221 | MRNA export factor MEX67; nuclear protein, repeat, | 100.0 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 100.0 | |
| 2qiy_A | 154 | UBP3-associated protein BRE5; deubiquitylation, ub | 99.93 | |
| 1oai_A | 59 | Nuclear RNA export factor; nuclear transport, nucl | 99.91 | |
| 1zo2_A | 129 | NTF2, nuclear transport factor 2; structural genom | 99.91 | |
| 1gy6_A | 127 | Nuclear transport factor 2; 1.6A {Rattus norvegicu | 99.91 | |
| 3nv0_B | 154 | NTF2-related export protein; NTF2-like domain, bet | 99.91 | |
| 1gy7_A | 125 | Nuclear transport factor 2; protein transport; 1.6 | 99.9 | |
| 1jkg_A | 140 | P15; NTF2-like domain, transport protein; 1.90A {H | 99.9 | |
| 3q90_A | 140 | RAS GTPase-activating protein-binding protein 1; s | 99.89 | |
| 2jp7_A | 57 | MRNA export factor MEX67; solution MEX67, UBA, tra | 99.88 | |
| 3ujm_A | 120 | Rasputin; NTF2-like fold, RAS signaling, signaling | 99.88 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.07 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.0 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.96 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.73 | |
| 1q42_A | 201 | MTR2, mRNA transport regulator MTR2; NTF2-fold, nu | 98.64 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.51 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.46 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.37 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.31 | |
| 1of5_B | 184 | MTR2, YKL186C, mRNA transport regulator MTR2; nucl | 98.28 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.2 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.19 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.19 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.18 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.18 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.16 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.16 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.14 | |
| 1v92_A | 46 | NSFL1 cofactor P47; 3-helix bundle, recombination; | 98.11 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.1 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.08 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.07 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.05 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.05 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.05 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.04 | |
| 2dal_A | 62 | Protein KIAA0794; FAS associted factor 1, UBA-like | 98.03 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.03 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.02 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 97.99 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.99 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 97.99 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.98 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.97 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 97.97 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.97 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.96 | |
| 2dam_A | 67 | ETEA protein; KIAA0887, UBA-like domain, structura | 97.95 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.95 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 97.94 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.93 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 97.93 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.9 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.9 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.89 | |
| 3e21_A | 45 | HFAF1, FAS-associated factor 1; UBA, alternative s | 97.88 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.87 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.87 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.87 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.87 | |
| 2dzl_A | 66 | Protein FAM100B; UBA-like domain, structural genom | 97.85 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.83 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.82 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.79 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.79 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.79 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.78 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.78 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.77 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.77 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.76 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.75 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.74 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.74 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 97.68 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.68 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.67 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.65 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.63 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 97.63 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.62 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.62 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.61 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.61 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.6 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.59 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.58 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 97.58 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.56 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.54 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.54 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.54 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.53 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.53 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.52 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.51 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.5 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.5 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.49 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.49 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.48 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.46 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.45 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.45 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 97.44 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.42 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.42 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.4 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 97.4 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.4 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.39 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 97.39 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.38 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.38 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.36 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.36 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.34 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.33 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.32 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.31 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.3 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.29 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.29 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.28 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.27 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.26 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.26 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.24 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.23 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.23 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.22 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.22 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.21 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.17 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.13 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 97.12 | |
| 3hx8_A | 129 | MLR2180 protein, putative ketosteroid isomerase; s | 97.11 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.09 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.07 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.06 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.06 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.04 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.0 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 96.99 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 96.99 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 96.94 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 96.93 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 96.92 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 96.92 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 96.91 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 96.9 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 96.88 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 96.87 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 96.86 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 96.86 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 96.83 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 96.8 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 96.75 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 96.71 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 96.65 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 96.65 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 96.64 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 96.64 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 96.54 | |
| 4i4k_A | 143 | Uncharacterized protein SGCJ; structural genomics, | 96.47 | |
| 3bq3_A | 270 | Defective in cullin neddylation protein 1; ubiquit | 96.46 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 96.27 | |
| 2l2d_A | 73 | OTU domain-containing protein 7A; UBA fold, struct | 96.23 | |
| 3d9r_A | 135 | Ketosteroid isomerase-like protein; YP_049581.1, s | 96.15 | |
| 3gzr_A | 146 | Uncharacterized protein with A NTF2-like fold; str | 96.15 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 96.15 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 95.83 | |
| 3h51_A | 156 | Putative calcium/calmodulin dependent protein KIN | 95.45 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 95.4 | |
| 3cu3_A | 172 | Domain of unknown function with A cystatin-like F; | 95.34 | |
| 2chc_A | 170 | Protein RV3472; hypothetical protein; 1.69A {Mycob | 95.15 | |
| 3b8l_A | 163 | Uncharacterized protein; putative aromatic ring hy | 95.13 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 95.1 | |
| 2rfr_A | 155 | Uncharacterized protein; structural genomics, join | 94.83 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 94.81 | |
| 2gxf_A | 142 | Hypothetical protein YYBH; alpha-beta protein., st | 94.69 | |
| 2cp9_A | 64 | EF-TS, EF-TSMT, elongation factor TS, mitochondria | 94.51 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 94.06 | |
| 1wj7_A | 104 | Hypothetical protein (RSGI RUH-015); UBA domain, u | 94.05 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 93.83 | |
| 2ux0_A | 143 | Calcium-calmodulin dependent protein kinase (CAM I | 93.81 | |
| 2rgq_A | 144 | Domain of unknown function with A cystatin-like F; | 93.65 | |
| 1z96_A | 40 | DNA-damage, UBA-domain protein MUD1; ubiquitin, th | 93.31 | |
| 4gew_A | 362 | 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosy | 93.2 | |
| 3f7s_A | 142 | Uncharacterized NTF2-like protein; structural geno | 93.03 | |
| 3a76_A | 176 | Gamma-hexachlorocyclohexane dehydrochlorinase; bar | 92.78 | |
| 3ef8_A | 150 | Putative scyalone dehydratase; YP_496742.1, struct | 92.37 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 92.31 | |
| 3rob_A | 139 | Uncharacterized conserved protein; structural geno | 92.08 | |
| 3fka_A | 120 | Uncharacterized NTF-2 like protein; structural gen | 92.05 | |
| 2rcd_A | 129 | Uncharacterized protein; structural genomics, join | 91.38 | |
| 3er7_A | 131 | Uncharacterized NTF2-like protein; YP_001812677.1, | 90.66 | |
| 3soy_A | 145 | NTF2-like superfamily protein; structural genomics | 90.6 | |
| 2owp_A | 129 | Hypothetical protein BXE_B1374; cystatin-like fold | 90.6 | |
| 1veg_A | 83 | NEDD8 ultimate buster-1; ubiquitin associated doma | 90.57 | |
| 3gwr_A | 144 | Putative calcium/calmodulin-dependent protein KIN | 88.94 | |
| 3bb9_A | 148 | Putative orphan protein; structural genomics, join | 87.43 | |
| 3b7c_A | 122 | Uncharacterized protein; NTF-2 like protein, struc | 86.39 | |
| 1ify_A | 49 | HHR23A, UV excision repair protein RAD23 homolog A | 86.24 | |
| 3blz_A | 128 | NTF2-like protein of unknown function; structural | 85.47 | |
| 2dak_A | 63 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 84.61 | |
| 1vg5_A | 73 | RSGI RUH-014, rhomboid family protein; UBA domain, | 84.37 | |
| 3duk_A | 125 | NTF2-like protein of unknown function; structural | 83.64 | |
| 3dm8_A | 143 | Uncharacterized protein RPA4348; siras, putative i | 82.9 | |
| 2g3q_A | 43 | Protein YBL047C; endocytosis, solution structure, | 82.75 | |
| 2knz_A | 53 | Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc | 82.25 | |
| 3ke7_A | 134 | Putative ketosteroid isomerase; structural genomic | 81.97 | |
| 2di0_A | 71 | Activating signal cointegrator 1 complex subunit 2 | 81.77 |
| >1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A | Back alignment and structure |
|---|
Probab=100.00 E-value=4.2e-70 Score=524.71 Aligned_cols=246 Identities=36% Similarity=0.643 Sum_probs=167.5
Q ss_pred CCCCCCCCcCChhhHHHHHHHHHHHhhcccccChhhHHhccccCceEEEEeecC---CCCCcchhhhcccCcccccCCCh
Q psy1142 190 LPKPQGSFLCHPEARDILRAFLEQYFALFDTESRAGLIDAYHENAQYSLVVTQG---LGNNHLLNNMLANSRNLLRIEEP 266 (442)
Q Consensus 190 ~P~~~~~f~~~~~~~~~~~~Fl~~yf~~~D~~~R~~L~~~Y~~~a~fSls~~~~---~~~~~~~~~Y~~~sRNl~~~~~~ 266 (442)
+|+++++|||++++++++++||++||.+||++||.+|.++|+++|+||+++++. +.+ .+|++|+++||||+|+++.
T Consensus 1 ~p~~~~~f~~~~~~~~~~~~Fv~~Yy~~fD~~~R~~L~~lY~~~s~fS~~~~~~~~~~~~-~~~~~Y~~~sRNl~~~~~~ 79 (250)
T 1jkg_B 1 APPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIPQNPAR-SSLAEYFKDSRNVKKLKDP 79 (250)
T ss_dssp CCCCCSCBCSSHHHHHHHHHHHHHHHHHHTSSCGGGGGGTEEEEEEEEEECCCC-------CCCHHHHTTBCCTTTCCCH
T ss_pred CCCcccCccCCHHHHHHHHHHHHHHHHHHCcCcHHHHHHhhCcCcEEEEEeCCCCCCccc-cchhhhhhhccchhcccch
Confidence 478999999999999999999999999999955999999999999999998865 222 5799999999999999999
Q ss_pred hhhhhhhccCHHHHHHHHHhCCCCccCCCCeeeeecCCCCCeEEEEEeeeEEEecCCCCCCCCCeeeEEEEEEEEeCCCC
Q psy1142 267 QRQKSLLSVGKADILRALRFLPATKHDLLSFTCDCPLYTPGLIQFSVCGLYEEITTGTKNKSKLIRAFNRAFLLVPRSGG 346 (442)
Q Consensus 267 ~~r~~~l~~G~~~I~~~l~~LP~t~H~~~sf~vD~~~~~~~~l~i~V~G~f~e~~~~~~~~~~~~r~F~RtFvl~p~~~~ 346 (442)
..|++++++|+++|+++|++||+|+|++++|+|||++.++++++|+|||.|+|. ++ ++ .+.+|+|+|||||+|+++|
T Consensus 80 ~~r~~~~~~G~~~I~~~l~~LP~t~H~~~s~~vD~~~~~~~~i~i~V~G~f~e~-~~-~~-~~~~r~F~rtFvL~p~~~~ 156 (250)
T 1jkg_B 80 TLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFKEV-DG-KS-RDSLRAFTRTFIAVPASNS 156 (250)
T ss_dssp HHHHHHSEESHHHHHHHHTTSCCEEECGGGCEEEEEEECSSCEEEEEEEEEEEC-SS-TT-TTCEEEEEEEEEEEECTTS
T ss_pred hhhhhhhccCHHHHHHHHHhCCCeeEeccceEEeeeecCCCEEEEEEEEEEEEC-CC-CC-CCCceeeEEEEEEEECCCC
Confidence 999999999999999999999999999999999999998899999999999997 43 22 4579999999999998777
Q ss_pred ceEEEcceeEeecCChhHHhhhhccccCCCCCCCCCCCchhhHHHHHHHHHHHHHhCCCHHHHHHHHHhcCCCHHHHHHH
Q psy1142 347 GFAITNDQLFITSATPEQAEKAFSSQVTASESTCSTPVSNEILIKQNMVKALSQVSGMNLNFSEKCLNEVQWDYDQAVTI 426 (442)
Q Consensus 347 ~~~I~ND~l~ir~~s~~~~~~~~~~~~~~p~~~~~~p~~~~~~~q~~mv~~~~~~Tgmn~~~s~~cL~~~~Wd~~~A~~~ 426 (442)
+|+|+||+|+||++++.+++.+++.++|+|++++ +|.+ +++|++||.+|+++||||++||+||||+|||||++|+++
T Consensus 157 ~~~I~ND~l~l~~~s~~~~~~~~~~~~~~p~~~~-~p~~--~~~q~~~v~~~~~~T~mn~~~s~~cL~~~~Wd~~~A~~~ 233 (250)
T 1jkg_B 157 GLCIVNDELFVRNASSEEIQRAFAMPAPTPSSSP-VPTL--SPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQA 233 (250)
T ss_dssp SEEEEEEEEEEEECCHHHHHHHHCCCCCCC--------------------------------------------------
T ss_pred cEEEEeeEEEEECCChhhhhhcccccCCCCCCCC-CCCC--CHHHHHHHHHHHHHhCCCHHHHHHHHHHcCCCHHHHHHH
Confidence 8999999999999999998888888888887665 6666 778999999999999999999999999999999999999
Q ss_pred HHhhhhcCCCCccccC
Q psy1142 427 FNQLKAKNALPSEAFI 442 (442)
Q Consensus 427 F~~l~~~~~iP~eAF~ 442 (442)
|++||++|+||+|||+
T Consensus 234 F~~l~~~~~IP~eAF~ 249 (250)
T 1jkg_B 234 FTHLKAKGEIPEVAFM 249 (250)
T ss_dssp ----------------
T ss_pred HHHHHhcCCCCHHHhc
Confidence 9999999999999995
|
| >3nv0_A Nuclear RNA export factor 2; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1q40_B MEX67, mRNA export factor MEX67; NTF2-fold, nuclear export, translation; 1.95A {Candida albicans} SCOP: d.17.4.2 | Back alignment and structure |
|---|
| >1of5_A MRNA export factor MEX67; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A | Back alignment and structure |
|---|
| >1oai_A Nuclear RNA export factor; nuclear transport, nuclear transport factor; 1.0A {Homo sapiens} SCOP: a.5.2.3 | Back alignment and structure |
|---|
| >1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 | Back alignment and structure |
|---|
| >1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A | Back alignment and structure |
|---|
| >3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A | Back alignment and structure |
|---|
| >1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A | Back alignment and structure |
|---|
| >3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} SCOP: d.17.4.0 | Back alignment and structure |
|---|
| >2jp7_A MRNA export factor MEX67; solution MEX67, UBA, translation; NMR {Saccharomyces cerevisiae} PDB: 2khh_A | Back alignment and structure |
|---|
| >3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1q42_A MTR2, mRNA transport regulator MTR2; NTF2-fold, nuclear export, translation; 1.75A {Candida albicans} SCOP: d.17.4.2 PDB: 1q40_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1of5_B MTR2, YKL186C, mRNA transport regulator MTR2; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2l2d_A OTU domain-containing protein 7A; UBA fold, structural genomics, PSI-biology, protein structur initiative, northeast structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27 | Back alignment and structure |
|---|
| >3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28 | Back alignment and structure |
|---|
| >2chc_A Protein RV3472; hypothetical protein; 1.69A {Mycobacterium tuberculosis} SCOP: d.17.4.25 | Back alignment and structure |
|---|
| >3b8l_A Uncharacterized protein; putative aromatic ring hydroxylase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.75A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2rfr_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.16A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22 | Back alignment and structure |
|---|
| >2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A* | Back alignment and structure |
|---|
| >2rgq_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.80A {Nostoc punctiforme} SCOP: d.17.4.25 | Back alignment and structure |
|---|
| >1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >4gew_A 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosyl-DNA diesterase, hydrolase; 2.35A {Caenorhabditis elegans} PDB: 4f1i_A | Back alignment and structure |
|---|
| >3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3a76_A Gamma-hexachlorocyclohexane dehydrochlorinase; barrel fold, lyase, detoxification; HET: SPD; 2.25A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >3ef8_A Putative scyalone dehydratase; YP_496742.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE PG4; 1.50A {Novosphingobium aromaticivorans DSM12444} SCOP: d.17.4.28 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >3fka_A Uncharacterized NTF-2 like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.69A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18 | Back alignment and structure |
|---|
| >3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, struc genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24 | Back alignment and structure |
|---|
| >3soy_A NTF2-like superfamily protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.00A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2owp_A Hypothetical protein BXE_B1374; cystatin-like fold, DUF3225 family protein, structural genom joint center for structural genomics, JCSG; 2.00A {Burkholderia xenovorans} SCOP: d.17.4.18 | Back alignment and structure |
|---|
| >1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259} | Back alignment and structure |
|---|
| >3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16 | Back alignment and structure |
|---|
| >3b7c_A Uncharacterized protein; NTF-2 like protein, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.70A {Shewanella oneidensis} SCOP: d.17.4.16 | Back alignment and structure |
|---|
| >1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3blz_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.75A {Shewanella baltica} SCOP: d.17.4.14 | Back alignment and structure |
|---|
| >2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3duk_A NTF2-like protein of unknown function; structural genomics, joint center for STR genomics, JCSG, protein structure initiative; HET: MSE; 2.20A {Methylobacillus flagellatus KT} SCOP: d.17.4.0 | Back alignment and structure |
|---|
| >3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20 | Back alignment and structure |
|---|
| >2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ke7_A Putative ketosteroid isomerase; structural genomics, joint C structural genomics, JCSG, protein structure initiative; HET: MSE BCN; 1.45A {Parabacteroides distasonis atcc 8503} | Back alignment and structure |
|---|
| >2di0_A Activating signal cointegrator 1 complex subunit 2; ASCC2, CUE domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.4 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 442 | ||||
| d1jkgb_ | 186 | d.17.4.2 (B:) NTF2-like domain of Tip associating | 2e-54 | |
| d1of5a_ | 221 | d.17.4.2 (A:) NTF2-like domain of mRNA export fact | 2e-39 | |
| d1q40b_ | 205 | d.17.4.2 (B:) NTF2-like domain of mRNA export fact | 1e-36 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 1e-30 | |
| d1oaia_ | 59 | a.5.2.3 (A:) FG-binding, C-terminal domain of TAP | 4e-18 | |
| d2qiya1 | 139 | d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {B | 1e-13 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 2e-07 | |
| d1gy6a_ | 125 | d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {R | 4e-06 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 6e-06 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.004 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-05 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 7e-04 | |
| d1gy7a_ | 121 | d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {B | 3e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 6e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 1e-04 | |
| d1zo2a1 | 117 | d.17.4.2 (A:10-126) Nuclear transport factor-2 (NT | 7e-05 | |
| d2omxa2 | 199 | c.10.2.1 (A:37-235) Internalin B {Listeria monocyt | 6e-04 | |
| d1jkga_ | 139 | d.17.4.2 (A:) NTF2-related export protein 1 (p15) | 0.002 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 0.003 |
| >d1jkgb_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]} Length = 186 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cystatin-like superfamily: NTF2-like family: NTF2-like domain: NTF2-like domain of Tip associating protein, TAP species: Human (Homo sapiens) [TaxId: 9606]
Score = 177 bits (451), Expect = 2e-54
Identities = 61/182 (33%), Positives = 105/182 (57%), Gaps = 5/182 (2%)
Query: 191 PKPQGSFLCHPEARDILRAFLEQYFALFDTESRAGLIDAYHENAQYSLVVTQGLGNNHL- 249
P +GS+ + ++ FL+QY+A++D+ R GL+DAYH+ A SL + N
Sbjct: 2 PPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIPQNPARS 61
Query: 250 -LNNMLANSRNLLRIEEPQRQKSLLSVGKADILRALRFLPATKHDLLSFTCDCPLYTPGL 308
L +SRN+ ++++P + LL + +++ L LP T+HD+ SF D T L
Sbjct: 62 SLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTL 121
Query: 309 IQFSVCGLYEEITTGTKNKSKLIRAFNRAFLLVPRSGGGFAITNDQLFITSATPEQAEKA 368
+ FSV G+++E+ +++ +RAF R F+ VP S G I ND+LF+ +A+ E+ ++A
Sbjct: 122 LCFSVNGVFKEVDGKSRD---SLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRA 178
Query: 369 FS 370
F+
Sbjct: 179 FA 180
|
| >d1of5a_ d.17.4.2 (A:) NTF2-like domain of mRNA export factor MEX67 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 221 | Back information, alignment and structure |
|---|
| >d1q40b_ d.17.4.2 (B:) NTF2-like domain of mRNA export factor MEX67 {Yeast (Candida albicans) [TaxId: 5476]} Length = 205 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1oaia_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]} Length = 59 | Back information, alignment and structure |
|---|
| >d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 139 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 125 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 121 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} Length = 117 | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 | Back information, alignment and structure |
|---|
| >d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 442 | |||
| d1jkgb_ | 186 | NTF2-like domain of Tip associating protein, TAP { | 100.0 | |
| d1of5a_ | 221 | NTF2-like domain of mRNA export factor MEX67 {Bake | 100.0 | |
| d1q40b_ | 205 | NTF2-like domain of mRNA export factor MEX67 {Yeas | 100.0 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 99.93 | |
| d1oaia_ | 59 | FG-binding, C-terminal domain of TAP {Human (Homo | 99.93 | |
| d2qiya1 | 139 | UBP3-associated protein BRE5 {Baker's yeast (Sacch | 99.86 | |
| d1zo2a1 | 117 | Nuclear transport factor-2 (NTF2) {Cryptosporidium | 99.84 | |
| d1gy7a_ | 121 | Nuclear transport factor-2 (NTF2) {Baker's yeast ( | 99.82 | |
| d1gy6a_ | 125 | Nuclear transport factor-2 (NTF2) {Rat (Rattus nor | 99.8 | |
| d1jkga_ | 139 | NTF2-related export protein 1 (p15) {Human (Homo s | 99.79 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.38 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.23 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.18 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.54 | |
| d1of5b_ | 165 | mRNA transport regulator MTR2 {Baker's yeast (Sacc | 98.5 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.45 | |
| d1v92a_ | 46 | NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { | 98.35 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.21 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.11 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.08 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.04 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.03 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.01 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.98 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.98 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.87 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.84 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.82 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.79 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.7 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.7 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.67 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.63 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.54 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.48 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 97.28 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 97.2 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.14 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.14 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.12 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 97.03 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 96.97 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 96.92 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 96.91 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.89 | |
| d3d9ra1 | 132 | Uncharacterized protein ECA1476 {Pectobacterium at | 96.85 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 96.78 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.64 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 96.58 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.55 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 96.48 | |
| d2owpa1 | 128 | Hypothetical protein BxeB1374 {Burkholderia xenovo | 96.45 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 96.34 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.29 | |
| d2gxfa1 | 128 | Hypothetical protein YybH {Bacillus subtilis [TaxI | 96.12 | |
| d2rcda1 | 127 | Uncharacterized protein ECA3500 {Pectobacterium at | 95.86 | |
| d3cu3a1 | 162 | Uncharacterized protein NpunR1993 {Nostoc punctifo | 95.85 | |
| d1xb2b1 | 56 | Elongation factor Ts (EF-Ts), N-terminal domain {C | 95.84 | |
| d1aipc1 | 52 | Elongation factor Ts (EF-Ts), N-terminal domain {T | 95.71 | |
| d1efub3 | 54 | Elongation factor Ts (EF-Ts), N-terminal domain {E | 95.52 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 95.29 | |
| d3bb9a1 | 121 | Uncharacterized protein Sfri1973 {Shewanella frigi | 95.26 | |
| d1oh0a_ | 125 | Delta-5-3-ketosteroid isomerase, steroid delta-iso | 94.85 | |
| d2a15a1 | 132 | Hypothetical protein Rv0760c {Mycobacterium tuberc | 94.43 | |
| d2ux0a1 | 135 | Association domain of calcium/calmodulin-dependent | 94.16 | |
| d2rgqa1 | 133 | Uncharacterized protein NpunR3134 {Nostoc punctifo | 93.9 | |
| d3b7ca1 | 121 | Uncharacterized protein SO0125 {Shewanella oneiden | 93.44 | |
| d3en8a1 | 127 | Uncharacterized protein BxeB2092 {Burkholderia xen | 93.07 | |
| d1ohpa1 | 125 | Delta-5-3-ketosteroid isomerase, steroid delta-iso | 91.84 | |
| d3dmca1 | 133 | Uncharacterized protein Ava2261 {Anabaena variabil | 91.2 | |
| d3blza1 | 124 | Uncharacterized protein Sbal0622 {Shewanella balti | 91.1 | |
| d1ulib_ | 177 | Biphenyl dioxygenase small subunit BphA2 {Rhodococ | 91.06 | |
| d2f86b1 | 129 | Association domain of calcium/calmodulin-dependent | 90.94 | |
| d1q42a_ | 174 | mRNA transport regulator MTR2 {Yeast (Candida albi | 90.62 | |
| d1z1sa1 | 129 | Uncharacterized protein PA3332 {Pseudomonas aerugi | 89.76 | |
| d2rfra1 | 153 | Uncharacterized protein Saro3722 {Novosphingobium | 88.0 | |
| d2r4ia1 | 122 | Uncharacterized protein CHU142 {Cytophaga hutchins | 87.4 | |
| d1m98a2 | 142 | Orange carotenoid protein, C-terminal domain {Cyan | 86.54 | |
| d3ebya1 | 157 | Putative hydroxylase subunit Saro3860 {Novosphingo | 86.4 | |
| d2chca1 | 167 | Uncharacterized protein Rv3472 {Mycobacterium tube | 86.23 | |
| d1wqlb1 | 182 | Small subunit of cumene dioxygenase CumA2 {Pseudom | 85.54 | |
| d1s5aa_ | 139 | Hypothetical protein YesE {Bacillus subtilis [TaxI | 81.24 | |
| d3dm8a1 | 135 | Uncharacterized protein Rpa4348 {Rhodopseudomonas | 81.2 | |
| d2b1xb1 | 167 | Naphthalene 1,2-dioxygenase beta subunit {Rhodococ | 81.13 |
| >d1jkgb_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cystatin-like superfamily: NTF2-like family: NTF2-like domain: NTF2-like domain of Tip associating protein, TAP species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=8.2e-54 Score=389.37 Aligned_cols=183 Identities=34% Similarity=0.619 Sum_probs=169.6
Q ss_pred CCCCCCCcCChhhHHHHHHHHHHHhhcccccChhhHHhccccCceEEEEeecCCCC--CcchhhhcccCcccccCCChhh
Q psy1142 191 PKPQGSFLCHPEARDILRAFLEQYFALFDTESRAGLIDAYHENAQYSLVVTQGLGN--NHLLNNMLANSRNLLRIEEPQR 268 (442)
Q Consensus 191 P~~~~~f~~~~~~~~~~~~Fl~~yf~~~D~~~R~~L~~~Y~~~a~fSls~~~~~~~--~~~~~~Y~~~sRNl~~~~~~~~ 268 (442)
|++|++||+++++++++++||++||.+||++||++|+++||++|+||||+++.+.. ..+|+.|+++||||+|+++...
T Consensus 2 Pp~k~~ff~~~~~~~lv~~Fl~~yf~~yDs~dR~~Ll~~Y~~~a~FSlsv~~~~~~~~~~~~~~Y~~~SRNl~k~~~~~~ 81 (186)
T d1jkgb_ 2 PPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIPQNPARSSLAEYFKDSRNVKKLKDPTL 81 (186)
T ss_dssp CCCCSCBCSSHHHHHHHHHHHHHHHHHHTSSCGGGGGGTEEEEEEEEEECCCC------CCCHHHHTTBCCTTTCCCHHH
T ss_pred CCCCCCccCCHHHHHHHHHHHHHHHHHhCCcCHHHHHHhcCcccEEEEecCCCCCCCCccchHHHhhhCcCccccCCHHH
Confidence 67899999999999999999999999999989999999999999999999877211 2789999999999999999999
Q ss_pred hhhhhccCHHHHHHHHHhCCCCccCCCCeeeeecCCCCCeEEEEEeeeEEEecCCCCCCCCCeeeEEEEEEEEeCCCCce
Q psy1142 269 QKSLLSVGKADILRALRFLPATKHDLLSFTCDCPLYTPGLIQFSVCGLYEEITTGTKNKSKLIRAFNRAFLLVPRSGGGF 348 (442)
Q Consensus 269 r~~~l~~G~~~I~~~l~~LP~t~H~~~sf~vD~~~~~~~~l~i~V~G~f~e~~~~~~~~~~~~r~F~RtFvl~p~~~~~~ 348 (442)
|+++|++|+++|+++|++||+|+||+.+|.+|++.+++.+++|+|||+|+|. ++ ++ ...+|+|+|||||+|+++|||
T Consensus 82 r~~~l~~G~~~Iv~~l~~LP~T~Hd~~sf~vD~~~~~~~~l~itV~G~F~E~-~~-~~-~~~~rsF~RTFil~P~~~~~~ 158 (186)
T d1jkgb_ 82 RFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFKEV-DG-KS-RDSLRAFTRTFIAVPASNSGL 158 (186)
T ss_dssp HHHHSEESHHHHHHHHTTSCCEEECGGGCEEEEEEECSSCEEEEEEEEEEEC-SS-TT-TTCEEEEEEEEEEEECTTSSE
T ss_pred HHHHHhhCHHHHHHHHHHCCCceecccccceeEeeccCCEEEEEEeeEEEec-CC-CC-CcceeEEEEEEEEeecCCCce
Confidence 9999999999999999999999999999999999999999999999999997 44 23 567999999999999988899
Q ss_pred EEEcceeEeecCChhHHhhhhccccCCC
Q psy1142 349 AITNDQLFITSATPEQAEKAFSSQVTAS 376 (442)
Q Consensus 349 ~I~ND~l~ir~~s~~~~~~~~~~~~~~p 376 (442)
+|+||||+||++++++++++|+.|+|+|
T Consensus 159 ~I~nD~L~Ir~~s~~~~~~af~~P~p~p 186 (186)
T d1jkgb_ 159 CIVNDELFVRNASSEEIQRAFAMPAPTP 186 (186)
T ss_dssp EEEEEEEEEEECCHHHHHHHHCCCCCCC
T ss_pred EEEecEEEEECCCHHHhhhccCCCCCCC
Confidence 9999999999999999999999888775
|
| >d1of5a_ d.17.4.2 (A:) NTF2-like domain of mRNA export factor MEX67 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q40b_ d.17.4.2 (B:) NTF2-like domain of mRNA export factor MEX67 {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oaia_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1of5b_ d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]} | Back information, alignment and structure |
|---|
| >d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rgqa1 d.17.4.25 (A:1-133) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d3blza1 d.17.4.14 (A:3-126) Uncharacterized protein Sbal0622 {Shewanella baltica [TaxId: 62322]} | Back information, alignment and structure |
|---|
| >d1ulib_ d.17.4.4 (B:) Biphenyl dioxygenase small subunit BphA2 {Rhodococcus sp. (strain RHA1) [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1q42a_ d.17.4.2 (A:) mRNA transport regulator MTR2 {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2rfra1 d.17.4.28 (A:1-153) Uncharacterized protein Saro3722 {Novosphingobium aromaticivorans [TaxId: 48935]} | Back information, alignment and structure |
|---|
| >d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]} | Back information, alignment and structure |
|---|
| >d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]} | Back information, alignment and structure |
|---|
| >d3ebya1 d.17.4.4 (A:6-162) Putative hydroxylase subunit Saro3860 {Novosphingobium aromaticivorans [TaxId: 48935]} | Back information, alignment and structure |
|---|
| >d2chca1 d.17.4.25 (A:1-167) Uncharacterized protein Rv3472 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1wqlb1 d.17.4.4 (B:5-186) Small subunit of cumene dioxygenase CumA2 {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d2b1xb1 d.17.4.4 (B:513-679) Naphthalene 1,2-dioxygenase beta subunit {Rhodococcus sp. ncimb12038 [TaxId: 92694]} | Back information, alignment and structure |
|---|