Diaphorina citri psyllid: psy11457

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-----

MLDIHSTFNNSMKLKRKESPVVGDVGDLLLDMFDGAAGEAFQRAAATFCSRQQIALESLRERRRKDSRLNAFLTEAELNPLCRRLQLKDIIPTGMLRLTKYPLLFANLAKYTVDNENELTKVKRALDRSKEILNYVNQAVKEAEDQHRLAEIQKRLDRTPFEKVDNPLVNEYRNLDLTRHKLIYEGNLQLRIATTRQKLIELYVLLLEDIIVLLQKQDDSKSFDSPSNSCEAVSSSGPPPPSSSSRVPWDSDTEAEPDPPDWTKSVPEDILRSLSPREKKRQEVINDRSALYLVNTSQHSAQIYDLVASSASERK

cHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHcccccccccEEEEEEEEEEEEcccccccEEEEEEEcccEEEEEEEccccccEEccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccEEEEEEEcccccEEEEEEEccccccc

MLDIHSTFNNSMKLKRKESPVVGDVGDLLLDMFDGAAGEAFQRAAATFCSRQQIALESLRERRRKDSRLNAFLTEAELNPLCRRLQLKDIIPTGMLRLTKYPLLFANLAKYTVDNENELTKVKRALDRSKEILNYVNQAVKEAEDQHRLAEIQKRLDRTPFEKVDNPLVNEYRNLDLTRHKLIYEGNLQLRIATTRQKLIELYVLLLEDIIVLLQKQDDSKS*********************************************EDILR*****EKKRQEVINDRSALYLVNTSQHSAQIYDL**S******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLDIHSTFNNSMKLKRKESPVVGDVGDLLLDMFDGAAGEAFQRAAATFCSRQQIALESLRERRRKDSRLNAFLTEAELNPLCRRLQLKDIIPTGMLRLTKYPLLFANLAKYTVDNENELTKVKRAxxxxxxxxxxxxxxxxxxxxxHRLAEIQKRLDRTPFEKVDNPLVNEYRNLDLTRHKLIYEGNLQLRIATTRQKLIELYVLLLEDIIVLLQKQDDSKSFDSPSNSCEAVSSSGPPPPSSSSRVPWDSDTEAEPDPPDWTKSVPEDILRSLSPREKKRQEVINDRSALYLVNTSQHSAQIYDLVASSASERK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0001664 [MF]	G-protein coupled receptor binding	probable	GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0007186 [BP]	G-protein coupled receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T06, chain A
Confidence level:very confident
Coverage over the Query: 1-225,257-315
View the alignment between query and template
View the model in PyMOL