Diaphorina citri psyllid: psy11458


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MTPPPVVNGGRRSYSESDYTYIDIVSQNDIYAGNDCRWSPGYWKICNEYCEYQNQEYQMNMEYFDGAAGEAFQRAAATFCSRQQIALESLRERRRKDSRLNAFLTEAELNPLCRRLQLKDIIPTGMLREQTSYSSLHVQKILTFIFPWRLGTIEWFVES
ccccccccccccccccccccHHEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHHcc
********GGRRSYSESDYTYIDIVSQNDIYAGNDCRWSPGYWKICNEYCEYQNQEYQMNMEYFDGAAGEAFQRAAATFCSRQQIALESLRERRRKDSRLNAFLTEAELNPLCRRLQLKDIIPTGMLREQTSYSSLHVQKILTFIFPWRLGTIEWFV**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPPPVVNGGRRSYSESDYTYIDIVSQNDIYAGNDCRWSPGYWKICNEYCEYQNQEYQMNMEYFDGAAGEAFQRAAATFCSRQQIALESLRERRRKDSRLNAFLTEAELNPLCRRLQLKDIIPTGMLREQTSYSSLHVQKILTFIFPWRLGTIEWFVES

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Rho guanine nucleotide exchange factor 12 May play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13). Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase and may act as GTPase-activating protein (GAP) for GNA12 and GNA13.confidentQ8R4H2
Rho guanine nucleotide exchange factor 12 May play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13). Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase and may act as GTPase-activating protein (GAP) for GNA12 and GNA13.confidentQ9NZN5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007186 [BP]G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0001664 [MF]G-protein coupled receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XCG, chain A
Confidence level:very confident
Coverage over the Query: 40-146
View the alignment between query and template
View the model in PyMOL