Diaphorina citri psyllid: psy11482


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MSSSPDTDRFKTNDLAMRVQKKLASKMSNKSMVKMYIDDRSGRLLDNLYRVIKTYVSFRHQSGNGKDTNNKKQSEKIIKTLIKIIIKTTLLVKNHQFSSTELTTCETLKAKFHTLLMSLISFYEVDFSYDAAYLIRQLTTLRSQLAGLLQRHLTSKNLTNLDNLYYCLKVLC
cccccccccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHc
***************AMRVQKKLAS*MSNKSMVKMYIDDRSGRLLDNLYRVIKTYVSFRH***************KIIKTLIKIIIKTTLLVKNHQFSSTELTTCETLKAKFHTLLMSLISFYEVDFSYDAAYLIRQLTTLRSQLAGLLQRHLTSKNLTNLDNLYYCLKVLC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSPDTDRFKTNDLAMRVQKKLASKMSNKSMVKMYIDDRSGRLLDNLYRVIKTYVSFRHQSGNGKDTNNKKQSEKIIKTLIKIIIKTTLLVKNHQFSSTELTTCETLKAKFHTLLMSLISFYEVDFSYDAAYLIRQLTTLRSQLAGLLQRHLTSKNLTNLDNLYYCLKVLC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tumor necrosis factor alpha-induced protein 8-like protein confidentQ28ZG0
Tumor necrosis factor alpha-induced protein 8 Acts as a negative mediator of apoptosis. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.confidentQ921Z5
Tumor necrosis factor alpha-induced protein 8 Acts as a negative mediator of apoptosis. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.confidentA4IF78

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043027 [MF]cysteine-type endopeptidase inhibitor activity involved in apoptotic processprobableGO:0004866, GO:0030234, GO:0061134, GO:0043028, GO:0003674, GO:0030414, GO:0004869, GO:0004857, GO:0061135
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0043154 [BP]negative regulation of cysteine-type endopeptidase activity involved in apoptotic processprobableGO:0019222, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0044699, GO:0051346, GO:2000116, GO:2000117, GO:0043086, GO:0043067, GO:0010466, GO:0065007, GO:0044092, GO:0043281, GO:0065009, GO:0010259, GO:0006915, GO:0052547, GO:0052548, GO:0009987, GO:0050794, GO:0012501, GO:0044763, GO:0010951, GO:0051336, GO:0050790, GO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F4M, chain A
Confidence level:very confident
Coverage over the Query: 37-57,70-170
View the alignment between query and template
View the model in PyMOL