Diaphorina citri psyllid: psy11489


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430---
MAEAQQESEKKLITIVVKTPKEKQNIEIEEDASVTDFKEAVAKKFNALPEQLCLIFAGKIMKDHENLSNHNMKDGLTSLKQLPLTKEIMHPKEEPTLMSEQLHLVLVRWEVSGICHHENLSNHNMKDGLTSLKQLPLTKEITHPKEEPILMSEQLHLVLVRWEAQMQQMLPQFLQQMQNPEIQGMMANPEALSAIQQIQAGIEQLRTAAPGMEWNFRNPEINHMLNNPELLRQTMEMARNPSMLQELMRTQDRALSNLESIPGGYSALQRMYRDIQEPMLNAATQQFSRNPYESNSSGGNPGRVKAPFRRSKRYLGPRQCARPSSSLSTPGLANNQGGNAQAPPEVRYRSQLDQLTAMGFVNREANLQGSLFGNAGMQSMMQQMMANPQLMQNMMQAPYMQSMLQAMSADPSIAQRVIGTNPLLQNSPELQTI
ccccccccccccEEEEEEccccCEEEEEcccccHHHHHHHHHHHHccccccEEEEEcccccccccHHHccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHccHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccHHHcccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccHHHHHHHccHHHHHHHHHHHcccHHHHHHcccccccccccccccc
************ITIVVKTPKEKQNIEIEEDASVTDFKEAVAKKFNALPEQLCLIFAGKIMKDHENLSNHNMKDGLT**********************************************************************PILMSEQLHLVLVRWEAQMQQMLPQFL********************IQQIQAGIEQLRTAAPGMEWNFRN**********************************************************************************************************************************************V************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEAQQESEKKLITIVVKTPKEKQNIEIEEDASVTDFKEAVAKKFNALPEQLCLIFAGKIMKDHENLSNHNMKDGLTSLKQLPLTKEIMHPKEEPTLMSEQLHLVLVRWEVSGICHHENLSNHNMKDGLTSLKQLPLTKEITHPKEEPILMSEQLHLVLVRWEAQMQQMLPQFLQQMQNPEIQGMMANPEALSAIQQIQAGIEQLRTAAPGMEWNFRNPEINHMLNNPELLRQTMEMARNPSMLQELMRTQDRALSNLESIPGGYSALQRMYRDIQEPMLNAATQQFSRNPYESNSSGGNPGRVKAPFRRSKRYLGPRQCARPSSSLSTPGLANNQGGNAQAPPEVRYRSQLDQLTAMGFVNREANLQGSLFGNAGMQSMMQQMMANPQLMQNMMQAPYMQSMLQAMSADPSIAQRVIGTNPLLQNSPELQTI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquilin-1 Links CD47 to the cytoskeleton. Promotes the surface expression of GABA-A receptors. Promotes the accumulation of uncleaved PSEN1 and PSEN2 by stimulating their biosynthesis. Has no effect on PSEN1 and PSEN2 degradation.confidentQ9JJP9
Ubiquilin-1 Links CD47 to the cytoskeleton. Promotes the surface expression of GABA-A receptors. Promotes the accumulation of uncleaved PSEN1 and PSEN2 by stimulating their biosynthesis. Has no effect on PSEN1 and PSEN2 degradation.confidentQ8R317

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KLC, chain A
Confidence level:very confident
Coverage over the Query: 10-78
View the alignment between query and template
View the model in PyMOL
Template: 2DNA, chain A
Confidence level:confident
Coverage over the Query: 339-389
View the alignment between query and template
View the model in PyMOL
Template: 2LLV, chain A
Confidence level:probable
Coverage over the Query: 171-234
View the alignment between query and template
View the model in PyMOL
Template: 2LLW, chain A
Confidence level:probable
Coverage over the Query: 378-419
View the alignment between query and template
View the model in PyMOL
Template: 2LNM, chain A
Confidence level:probable
Coverage over the Query: 215-251
View the alignment between query and template
View the model in PyMOL