Psyllid ID: psy11489


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430---
MAEAQQESEKKLITIVVKTPKEKQNIEIEEDASVTDFKEAVAKKFNALPEQLCLIFAGKIMKDHENLSNHNMKDGLTSLKQLPLTKEIMHPKEEPTLMSEQLHLVLVRWEVSGICHHENLSNHNMKDGLTSLKQLPLTKEITHPKEEPILMSEQLHLVLVRWEAQMQQMLPQFLQQMQNPEIQGMMANPEALSAIQQIQAGIEQLRTAAPGMEWNFRNPEINHMLNNPELLRQTMEMARNPSMLQELMRTQDRALSNLESIPGGYSALQRMYRDIQEPMLNAATQQFSRNPYESNSSGGNPGRVKAPFRRSKRYLGPRQCARPSSSLSTPGLANNQGGNAQAPPEVRYRSQLDQLTAMGFVNREANLQGSLFGNAGMQSMMQQMMANPQLMQNMMQAPYMQSMLQAMSADPSIAQRVIGTNPLLQNSPELQTI
ccccccccccccEEEEEEccccEEEEEEcccccHHHHHHHHHHHHccccccEEEEEcccccccccHHHccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccHHHcccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccHHHHHHHccHHHHHHHHHHHcccHHHHHHcccccccccccccccc
cccccccccccEEEEEEEcccccEEEEEcccccHHHHHHHHHHHccccHHHEEEEEcccEccccHHHHHcccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHccHHHHHHHccHHHHHHHHHHcHHHHHHHHHccccccccccccHHHHcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHcccHHHHHHHHHHHHcHHHHHHHHHcccHHcccccHccc
MAEAQQESEKKLITIVVKtpkekqnieieedasvTDFKEAVAKKFNALPEQLCLIFAGKImkdhenlsnhnmkdgltslkqlpltkeimhpkeeptlmSEQLHLVLVRWEVSgichhenlsnhnmkdgltslkqlpltkeithpkeepilmSEQLHLVLVRWEAQMQQMLPQFLQQMQnpeiqgmmanpeALSAIQQIQAGIEQLRtaapgmewnfrnpeinhmlnnpELLRQTMEMARNPSMLQELMRTQDRALsnlesipggYSALQRMYRDIQEPMLNaatqqfsrnpyesnssggnpgrvkapfrrskrylgprqcarpssslstpglannqggnaqappevryrSQLDQLTAMGFVNREAnlqgslfgnAGMQSMMQQMMANPQLMQNMMQAPYMQSMLQAmsadpsiaqrvigtnpllqnspelqti
maeaqqesekklitivvktpkekqnieieedasvtdFKEAVAKKFNALPEQLCLIFAGKIMKDHENLSNHNMKDGLTSLKQLPLTKEIMHPKEEPTLMSEQLHLVLVRWEVSGICHHENLSNHNMKDGLTSLKQLPLTKEITHPKEEPILMSEQLHLVLVRWEAQMQQMLPQFLQQMQNPEIQGMMANPEALSAIQQIQAGIEQLRTAAPGMEWNFRNPEINHMLNNPELLRQTMEMARNPSMLQELMRTQDRALSNLESIPGGYSALQRMYRDIQEPMLNAATQQFSRnpyesnssggnpgrvkapFRRSKRylgprqcarpssslstpglannqggnaqapPEVRYRSQLDQLTAMGFVNREANLQGSLFGNAGMQSMMQQMMANPQLMQNMMQAPYMQSMLQAMSADPSIAQRVIgtnpllqnspelqti
MAEAQQESEKKLITIVVKTPKEKQNIEIEEDASVTDFKEAVAKKFNALPEQLCLIFAGKIMKDHENLSNHNMKDGLTSLKQLPLTKEIMHPKEEPTLMSEQLHLVLVRWEVSGICHHENLSNHNMKDGLTSLKQLPLTKEITHPKEEPILMSEQLHLVLVRWEAqmqqmlpqflqqmqNPEIQGMMANPEALSAIQQIQAGIEQLRTAAPGMEWNFRNPEINHMLNNPELLRQTMEMARNPSMLQELMRTQDRALSNLESIPGGYSALQRMYRDIQEPMLNAATQQFSRNPYESNSSGGNPGRVKAPFRRSKRYLGPRQCARPSSSLSTPGLANNQGGNAQAPPEVRYRSQLDQLTAMGFVNREANLQGSLFGNAGmqsmmqqmmANPQLMQNMMQAPYMQSMLQAMSADPSIAQRVIGTNPLLQNSPELQTI
************ITIVV***************SVTDFKEAVAKKFNALPEQLCLIFAGKIMKD************************************EQLHLVLVRWEVSGICHHENLSN*************************PILMSEQLHLVLVRWEAQMQQMLPQFL********************IQQIQAGIEQLRTAAPGMEWNFRN******************************************************************************************************************************************AMGFV************************************************************************
***************VVKTPKEKQNIEIEEDASVTDFKEAVAKKFNALPEQLCLIFAGKIMKDHENLSNHNMKDGLT********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************
*********KKLITIVVKTPKEKQNIEIEEDASVTDFKEAVAKKFNALPEQLCLIFAGKIMKDHENLSNHNMKDGLTSLKQLPLTKEIMHPKEEPTLMSEQLHLVLVRWEVSGICHHENLSNHNMKDGLTSLKQLPLTKEITHPKEEPILMSEQLHLVLVRWEAQMQQMLPQFLQQMQNPEIQGMMANPEALSAIQQIQAGIEQLRTAAPGMEWNFRNPEINHMLNNPELLRQTMEMARNPSMLQELMRTQDRALSNLESIPGGYSALQRMYRDIQEPMLNAATQQFSR**************VKAPFRRSKRYL***************GLANNQGGNAQAPPEVRYRSQLDQLTAMGFVNREANLQGSLFGNAGMQSMMQQMMANPQLMQNMMQAPYMQSMLQAMSADPSIAQRVIGTNPLLQNSPELQTI
*********KKLITIVVKTPKEKQNIEIEEDASVTDFKEAVAKKFNALPEQLCLIFAGKIMKDHENLSNHNMKDGLTSLKQLPLT***********************************************KQLPLTKEITHPKEEPILMSEQLHLVLVRWEAQMQQMLPQFLQQMQNPEIQGMMANPEALSAIQQIQAGIEQLRTAAPGMEWNFRNPEINHMLNNPELLRQTMEMARNPSMLQELMRTQDRALSNLESIPGGYSALQRMYRDIQEPMLNAATQQFSRNPYESNSS***************************************************************VNREANLQGSLFGNAGMQSMMQQMMANPQLMQNMMQAPYMQSMLQAMSADPSIAQRVIGTNPLLQNSP*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEAQQESEKKLITIVVKTPKEKQNIEIEEDASVTDFKEAVAKKFNALPEQLCLIFAGKIMKDHENLSNHNMKDGLTSLKQLPLTKEIMHPKEEPTLMSEQLHLVLVRWEVSGICHHENLSNHNMKDGLTSLKQLPLTKEITHPKEEPILMSEQLHLVLVRWEAQMQQMLPQFLQQMQNPEIQGMMANPEALSAIQQIQAGIEQLRTAAPGMEWNFRNPEINHMLNNPELLRQTMEMARNPSMLQELMRTQDRALSNLESIPGGYSALQRMYRDIQEPMLNAATQQFSRNPYESNSSGGNPGRVKAPFRRSKRYLGPRQCARPSSSLSTPGLANNQGGNAQAPPEVRYRSQLDQLTAMGFVNREANLQGSLFGNAGMQSMMQQMMANPQLMQNMMQAPYMQSMLQAMSADPSIAQRVIGTNPLLQNSPELQTI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query433 2.2.26 [Sep-21-2011]
Q9JJP9 582 Ubiquilin-1 OS=Rattus nor yes N/A 0.900 0.670 0.377 2e-65
Q8R317 582 Ubiquilin-1 OS=Mus muscul yes N/A 0.898 0.668 0.385 3e-65
Q5R684 589 Ubiquilin-1 OS=Pongo abel yes N/A 0.588 0.432 0.441 1e-47
Q9UMX0 589 Ubiquilin-1 OS=Homo sapie yes N/A 0.588 0.432 0.441 1e-47
Q9NRR5 601 Ubiquilin-4 OS=Homo sapie no N/A 0.542 0.391 0.433 3e-44
Q9QZM0 638 Ubiquilin-2 OS=Mus muscul no N/A 0.561 0.380 0.428 5e-44
Q99NB8 596 Ubiquilin-4 OS=Mus muscul no N/A 0.542 0.394 0.426 1e-43
Q8C5U9 658 Ubiquilin-3 OS=Mus muscul no N/A 0.577 0.379 0.353 9e-41
Q9H347 655 Ubiquilin-3 OS=Homo sapie no N/A 0.563 0.372 0.352 2e-40
Q8IYU4475 Ubiquilin-like protein OS no N/A 0.572 0.522 0.273 3e-19
>sp|Q9JJP9|UBQL1_RAT Ubiquilin-1 OS=Rattus norvegicus GN=Ubqln1 PE=1 SV=1 Back     alignment and function desciption
 Score =  250 bits (638), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 165/437 (37%), Positives = 240/437 (54%), Gaps = 47/437 (10%)

Query: 8   SEKKLITIVVKTPKEKQNIEIEEDASVTDFKEAVAKKFNALPEQLCLIFAGKIMKDHENL 67
           +E K++ + VKTPKEK+   + E++SV  FKE ++K+F +  +QL LIFAGKI+KD + L
Sbjct: 23  AEPKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRFKSHIDQLVLIFAGKILKDQDTL 82

Query: 68  SNHNMKDGLTSLKQLPLTKEIMHPKEEPTLMSEQLHLVLVRWEVSGICHHENLSNHNMKD 127
           S H + DGLT          ++  +  P   S Q          S      N ++    +
Sbjct: 83  SQHGIHDGLT-------VHLVIKTQNRPQDNSAQQTNTTGNSVTSSPAPDSNPTSGPAAN 135

Query: 128 GLTSLKQLPLTKEITHPKEEPILMSEQLHLVLVRWEAQMQQML---PQFLQQ-MQNPEIQ 183
               L  L     ++         SE         ++QMQ+ L   P+ + Q M+NP +Q
Sbjct: 136 SSFGLGGLGGLAGLSSLGLNTTNFSE--------LQSQMQRQLLSNPEMMVQIMENPFVQ 187

Query: 184 GMMANPEALSAIQQIQAGIEQLRTAAPGMEWNF-RNPEINHMLNNPELLRQTMEMARNPS 242
            M++NP+ +           QL  A P M+    RNPEI+HMLNNP ++RQT+E+ARNP+
Sbjct: 188 SMLSNPDLM----------RQLIMANPQMQQLIQRNPEISHMLNNPNIMRQTLELARNPA 237

Query: 243 MLQELMRTQDRALSNLESIPGGYSALQRMYRDIQEPMLNAATQQFSRNPYE------SNS 296
           M+QE+MR Q+R LSNLESIPGGY+AL+RMY DIQEPMLNAA +QF  NP+       S++
Sbjct: 238 MMQEMMRNQERDLSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASLVSSPSSA 297

Query: 297 SGGNPGRV--KAPFRRSKRYLGPRQCARPSSSLSTPGLANNQGGNAQAPPEVRYRSQLDQ 354
            G  P R   + P         P+      S+ ST    +   GNA + P  +  S  + 
Sbjct: 298 EGTQPSRTENRDPLPNPWAPQTPQSSPASGSTGSTTNTVSTSAGNATSTPAGQGTSGPNL 357

Query: 355 LTAMGFVNREANLQGSLFGNAGMQSMMQQMMANPQLMQNMMQAPYMQSMLQAMSADPSIA 414
           +   G          S+F   GMQS++QQ+  NPQLMQNM+ APYM+SM+Q++S +P +A
Sbjct: 358 VPGAG---------ASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLA 408

Query: 415 QRVIGTNPLLQNSPELQ 431
            +++  NPL   +P+LQ
Sbjct: 409 AQMMLNNPLFAGNPQLQ 425




Links CD47 to the cytoskeleton. Promotes the surface expression of GABA-A receptors. Promotes the accumulation of uncleaved PSEN1 and PSEN2 by stimulating their biosynthesis. Has no effect on PSEN1 and PSEN2 degradation.
Rattus norvegicus (taxid: 10116)
>sp|Q8R317|UBQL1_MOUSE Ubiquilin-1 OS=Mus musculus GN=Ubqln1 PE=1 SV=1 Back     alignment and function description
>sp|Q5R684|UBQL1_PONAB Ubiquilin-1 OS=Pongo abelii GN=UBQLN1 PE=2 SV=1 Back     alignment and function description
>sp|Q9UMX0|UBQL1_HUMAN Ubiquilin-1 OS=Homo sapiens GN=UBQLN1 PE=1 SV=2 Back     alignment and function description
>sp|Q9NRR5|UBQL4_HUMAN Ubiquilin-4 OS=Homo sapiens GN=UBQLN4 PE=1 SV=2 Back     alignment and function description
>sp|Q9QZM0|UBQL2_MOUSE Ubiquilin-2 OS=Mus musculus GN=Ubqln2 PE=1 SV=2 Back     alignment and function description
>sp|Q99NB8|UBQL4_MOUSE Ubiquilin-4 OS=Mus musculus GN=Ubqln4 PE=1 SV=1 Back     alignment and function description
>sp|Q8C5U9|UBQL3_MOUSE Ubiquilin-3 OS=Mus musculus GN=Ubqln3 PE=2 SV=1 Back     alignment and function description
>sp|Q9H347|UBQL3_HUMAN Ubiquilin-3 OS=Homo sapiens GN=UBQLN3 PE=1 SV=2 Back     alignment and function description
>sp|Q8IYU4|UBQLN_HUMAN Ubiquilin-like protein OS=Homo sapiens GN=UBQLNL PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query433
307171757 540 Ubiquilin-1 [Camponotus floridanus] 0.833 0.668 0.448 2e-77
357610612512 ubiquilin 1,2 [Danaus plexippus] 0.794 0.671 0.427 1e-70
195345799 546 GM22982 [Drosophila sechellia] gi|194134 0.819 0.650 0.406 2e-69
328704609 546 PREDICTED: ubiquilin-1-like isoform 2 [A 0.842 0.668 0.413 1e-68
20129061 547 ubiquilin [Drosophila melanogaster] gi|7 0.822 0.650 0.399 6e-68
340715311530 PREDICTED: ubiquilin-1-like isoform 2 [B 0.836 0.683 0.415 2e-67
332020650518 Ubiquilin-1 [Acromyrmex echinatior] 0.755 0.631 0.401 5e-67
307214968 534 Ubiquilin-1 [Harpegnathos saltator] 0.771 0.625 0.406 5e-67
328704607 541 PREDICTED: ubiquilin-1-like isoform 1 [A 0.838 0.670 0.404 6e-67
156539959532 PREDICTED: ubiquilin-1-like [Nasonia vit 0.764 0.622 0.411 1e-66
>gi|307171757|gb|EFN63468.1| Ubiquilin-1 [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  295 bits (756), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 196/437 (44%), Positives = 246/437 (56%), Gaps = 76/437 (17%)

Query: 1   MAEAQQESEKKLITIVVKTPKEKQNIEIEEDASVTDFKEAVAKKFNALPEQLCLIFAGKI 60
           MAE QQE   K ITI VKTPKEKQ +EIEE+A++ DFKEAV+KKFNA  +QLCLIFAGKI
Sbjct: 1   MAEGQQEGGPKKITINVKTPKEKQTVEIEENATIKDFKEAVSKKFNAQADQLCLIFAGKI 60

Query: 61  MKDHENLSNHNMKDGLTSLKQLPLTKEIMHPKEEPTLMSEQLHLVLVRWEVSGICHHENL 120
           MKDHE LS HN+KDGL                         +HLV+     S   + E+ 
Sbjct: 61  MKDHETLSTHNIKDGLA------------------------VHLVIKAPRTSSTQNQESN 96

Query: 121 SNHNMKDGLTSLKQLPLTKEITHPKEEPILMSEQLHLVLVRWEAQMQQML---PQFLQQ- 176
           S    +  + +     L         E + M        +  + +MQ+ L   P+ ++Q 
Sbjct: 97  STPRPQADV-NYSPFGLGSLGGLMGLESLGMGS---ANFIDLQQRMQRELLSNPETMRQV 152

Query: 177 MQNPEIQGMMANPEALSAIQQIQAGIEQLRTAAPGM-EWNFRNPEINHMLNNPELLRQTM 235
           + NP +Q +M +PE           +  L TA P M E   RNPEI+HMLNNPELLRQTM
Sbjct: 153 LDNPLVQSLMNDPE----------NMRNLVTANPQMQELMQRNPEISHMLNNPELLRQTM 202

Query: 236 EMARNPSMLQELMRTQDRALSNLESIPGGYSALQRMYRDIQEPMLNAATQQFSRNPYESN 295
           E+ARNPSMLQELMR+ DRALSNLESIPGGYSAL+RMYRDIQEPML AAT    RNP+ + 
Sbjct: 203 ELARNPSMLQELMRSHDRALSNLESIPGGYSALRRMYRDIQEPMLAAATN--GRNPFAAL 260

Query: 296 SSGGNPGRVKAPFRRSKRYLGPRQCARPSSSLSTP-GLANNQGGNAQAPPEVRYRSQLDQ 354
               N     A          P+Q       L  P G +    G  Q  P+ + RS LD 
Sbjct: 261 VENSNSSNQDA--------QNPQQGQENRDPLPNPWGQSQTDSGTGQ--PQSQSRSLLD- 309

Query: 355 LTAMGFVNREANLQGSLFGNAGMQSMMQQMMANPQLMQNMMQAPYMQSMLQAMSADPSIA 414
                              + GMQS+  QMM NPQLM+NM+ APY +SML+AM+ADP++A
Sbjct: 310 -------------------SPGMQSLTAQMMENPQLMRNMLNAPYTRSMLEAMAADPAMA 350

Query: 415 QRVIGTNPLLQNSPELQ 431
            RVI  NP L+ +P++Q
Sbjct: 351 NRVIAANPFLRGNPQMQ 367




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|357610612|gb|EHJ67063.1| ubiquilin 1,2 [Danaus plexippus] Back     alignment and taxonomy information
>gi|195345799|ref|XP_002039456.1| GM22982 [Drosophila sechellia] gi|194134682|gb|EDW56198.1| GM22982 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|328704609|ref|XP_003242547.1| PREDICTED: ubiquilin-1-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|20129061|ref|NP_608344.1| ubiquilin [Drosophila melanogaster] gi|7293631|gb|AAF49003.1| ubiquilin [Drosophila melanogaster] gi|21711699|gb|AAM75040.1| LD38919p [Drosophila melanogaster] gi|220947322|gb|ACL86204.1| Ubqn-PA [synthetic construct] gi|220956792|gb|ACL90939.1| Ubqn-PA [synthetic construct] Back     alignment and taxonomy information
>gi|340715311|ref|XP_003396159.1| PREDICTED: ubiquilin-1-like isoform 2 [Bombus terrestris] gi|350397412|ref|XP_003484871.1| PREDICTED: ubiquilin-1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332020650|gb|EGI61056.1| Ubiquilin-1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307214968|gb|EFN89813.1| Ubiquilin-1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328704607|ref|XP_001952173.2| PREDICTED: ubiquilin-1-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|156539959|ref|XP_001599129.1| PREDICTED: ubiquilin-1-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query433
UNIPROTKB|Q9UMX0 589 UBQLN1 "Ubiquilin-1" [Homo sap 0.547 0.402 0.437 2.6e-65
UNIPROTKB|Q95M59 595 UBQLN1 "Uncharacterized protei 0.547 0.398 0.433 8.7e-65
MGI|MGI:1860276 582 Ubqln1 "ubiquilin 1" [Mus musc 0.538 0.400 0.441 1.1e-64
UNIPROTKB|I3LSM3 589 UBQLN1 "Uncharacterized protei 0.547 0.402 0.433 2.3e-64
FB|FBgn0031057 547 Ubqn "Ubiquilin" [Drosophila m 0.521 0.413 0.428 2.9e-64
MGI|MGI:1860283 638 Ubqln2 "ubiquilin 2" [Mus musc 0.542 0.368 0.420 7.7e-64
RGD|1563566 638 Ubqln2 "ubiquilin 2" [Rattus n 0.542 0.368 0.421 1.6e-63
UNIPROTKB|F1N6D3 612 F1N6D3 "Uncharacterized protei 0.545 0.385 0.418 2.6e-63
MGI|MGI:2150152 596 Ubqln4 "ubiquilin 4" [Mus musc 0.545 0.395 0.411 4.2e-63
UNIPROTKB|Q9NRR5 601 UBQLN4 "Ubiquilin-4" [Homo sap 0.545 0.392 0.418 5.4e-63
UNIPROTKB|Q9UMX0 UBQLN1 "Ubiquilin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 489 (177.2 bits), Expect = 2.6e-65, Sum P(2) = 2.6e-65
 Identities = 112/256 (43%), Positives = 153/256 (59%)

Query:   179 NPEIQGMMANPEALSAIQQIQAGIEQLRTAAPGMEWNF-RNPEINHMLNNPELLRQTMEM 237
             NP +Q M++NP+ +           QL  A P M+    RNPEI+HMLNNP+++RQT+E+
Sbjct:   192 NPFVQSMLSNPDLM----------RQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLEL 241

Query:   238 ARNPSMLQELMRTQDRALSNLESIPGGYSALQRMYRDIQEPMLNAATQQFSRNPYESNSS 297
             ARNP+M+QE+MR QDRALSNLESIPGGY+AL+RMY DIQEPML+AA +QF  NP+ S  S
Sbjct:   242 ARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLSAAQEQFGGNPFASLVS 301

Query:   298 GGNPGRVKAPFRRSKRYLGPRQCARPSS--SLSTPGLANNQGGNAQAPPEVRYRSQLDQL 355
               + G    P R   R   P   A  +S  S ++ G A+  GG   +       +     
Sbjct:   302 NTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTASTVGGTTGSTAS---GTSGQST 358

Query:   356 TAMGFVNREANLQGSLFGNAGXXXXXXXXXANPQLMQNMMQAPYMQSMLQAMSADPSIAQ 415
             TA   V     +  S+F   G          NPQLMQNM+ APYM+SM+Q++S +P +A 
Sbjct:   359 TAPNLV---PGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAA 415

Query:   416 RVIGTNPLLQNSPELQ 431
             +++  NPL   +P+LQ
Sbjct:   416 QMMLNNPLFAGNPQLQ 431


GO:0000502 "proteasome complex" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0019900 "kinase binding" evidence=IPI
GO:0005737 "cytoplasm" evidence=IMP;IDA
GO:0048471 "perinuclear region of cytoplasm" evidence=IDA;NAS
GO:0005515 "protein binding" evidence=IPI
GO:0031396 "regulation of protein ubiquitination" evidence=IDA
GO:0001666 "response to hypoxia" evidence=IMP
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0006915 "apoptotic process" evidence=IMP
GO:0043234 "protein complex" evidence=IDA
UNIPROTKB|Q95M59 UBQLN1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1860276 Ubqln1 "ubiquilin 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|I3LSM3 UBQLN1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0031057 Ubqn "Ubiquilin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1860283 Ubqln2 "ubiquilin 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1563566 Ubqln2 "ubiquilin 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N6D3 F1N6D3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2150152 Ubqln4 "ubiquilin 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NRR5 UBQLN4 "Ubiquilin-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9JJP9UBQL1_RATNo assigned EC number0.37750.90060.6701yesN/A
Q8R317UBQL1_MOUSENo assigned EC number0.38580.89830.6683yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query433
cd0180871 cd01808, hPLIC_N, Ubiquitin-like domain of hPLIC-1 2e-33
cd0176969 cd01769, UBL, Ubiquitin-like domain of UBL 4e-13
cd0180972 cd01809, Scythe_N, Ubiquitin-like domain of Scythe 6e-13
pfam0024069 pfam00240, ubiquitin, Ubiquitin family 3e-11
smart0021372 smart00213, UBQ, Ubiquitin homologues 1e-08
cd0019669 cd00196, UBQ, Ubiquitin-like proteins 2e-08
cd0180577 cd01805, RAD23_N, Ubiquitin-like domain of RAD23 9e-07
cd0179870 cd01798, parkin_N, amino-terminal ubiquitin-like o 2e-06
cd0181271 cd01812, BAG1_N, Ubiquitin-like domain of BAG1 2e-06
PTZ0004476 PTZ00044, PTZ00044, ubiquitin; Provisional 1e-04
cd0180676 cd01806, Nedd8, Nebb8-like ubiquitin protein 5e-04
cd0180376 cd01803, Ubiquitin, Ubiquitin 0.003
>gnl|CDD|176403 cd01808, hPLIC_N, Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
 Score =  119 bits (301), Expect = 2e-33
 Identities = 45/65 (69%), Positives = 53/65 (81%)

Query: 13 ITIVVKTPKEKQNIEIEEDASVTDFKEAVAKKFNALPEQLCLIFAGKIMKDHENLSNHNM 72
          I + VKTPK+K+ IEI EDASV DFKEAV+KKF A  EQL LIFAGKI+KD + L+ HN+
Sbjct: 1  IKVTVKTPKDKEEIEIAEDASVKDFKEAVSKKFKANQEQLVLIFAGKILKDTDTLTQHNI 60

Query: 73 KDGLT 77
          KDGLT
Sbjct: 61 KDGLT 65


hPLIC-1 and hPLIC-2 (human homologs of the yeast ubiquitin-like Dsk2 protein) are type2 UBL's (ubiquitin-like) proteins that are thought to serve as adaptors that link the ubiquitination machinery to the proteasome. The hPLIC's have an N-terminal UBL domain that binds the S5a subunit of the proteasome and a C-terminal UBA (ubiquitin-associated) domain that binds a ubiquitylated protein. Length = 71

>gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL Back     alignment and domain information
>gnl|CDD|176404 cd01809, Scythe_N, Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family Back     alignment and domain information
>gnl|CDD|214563 smart00213, UBQ, Ubiquitin homologues Back     alignment and domain information
>gnl|CDD|176352 cd00196, UBQ, Ubiquitin-like proteins Back     alignment and domain information
>gnl|CDD|176400 cd01805, RAD23_N, Ubiquitin-like domain of RAD23 Back     alignment and domain information
>gnl|CDD|176393 cd01798, parkin_N, amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>gnl|CDD|176407 cd01812, BAG1_N, Ubiquitin-like domain of BAG1 Back     alignment and domain information
>gnl|CDD|185411 PTZ00044, PTZ00044, ubiquitin; Provisional Back     alignment and domain information
>gnl|CDD|176401 cd01806, Nedd8, Nebb8-like ubiquitin protein Back     alignment and domain information
>gnl|CDD|176398 cd01803, Ubiquitin, Ubiquitin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 433
KOG0010|consensus493 100.0
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 99.69
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 99.68
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 99.67
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 99.67
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 99.66
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 99.65
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 99.64
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 99.63
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 99.62
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 99.61
KOG0011|consensus340 99.61
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 99.6
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 99.6
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 99.6
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 99.6
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 99.6
PTZ0004476 ubiquitin; Provisional 99.59
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 99.59
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 99.58
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 99.58
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 99.57
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 99.54
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 99.53
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 99.48
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 99.46
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 99.43
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 99.39
KOG0005|consensus70 99.39
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 99.25
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 99.23
KOG0003|consensus128 99.19
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 99.17
KOG0004|consensus156 99.14
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 99.11
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 99.08
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 99.01
KOG4248|consensus 1143 98.98
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 98.84
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 98.83
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 98.73
PLN02560308 enoyl-CoA reductase 98.65
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 98.52
KOG0001|consensus75 98.48
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 98.42
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 98.28
KOG1872|consensus473 98.19
KOG0010|consensus 493 98.16
KOG0006|consensus446 98.05
KOG3493|consensus73 97.9
KOG1769|consensus99 97.84
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 97.69
PF1030297 DUF2407: DUF2407 ubiquitin-like domain; InterPro: 97.59
cd0181180 OASL_repeat1 2'-5' oligoadenylate synthetase-like 97.44
KOG4583|consensus391 97.35
KOG4495|consensus110 97.15
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 96.97
COG541781 Uncharacterized small protein [Function unknown] 96.78
smart0072741 STI1 Heat shock chaperonin-binding motif. 96.47
KOG3206|consensus234 96.47
COG5227103 SMT3 Ubiquitin-like protein (sentrin) [Posttransla 96.21
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 96.13
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 96.1
smart0016680 UBX Domain present in ubiquitin-regulatory protein 95.97
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 95.84
KOG0012|consensus380 95.73
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 95.66
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 95.54
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 95.51
KOG1639|consensus297 95.15
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 94.97
smart0072741 STI1 Heat shock chaperonin-binding motif. 94.83
KOG0013|consensus231 94.59
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 94.57
PF13019162 Telomere_Sde2: Telomere stability and silencing 94.35
cd0177485 Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i 94.27
PF1504476 CLU_N: Mitochondrial function, CLU-N-term 93.9
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 93.89
PRK0836470 sulfur carrier protein ThiS; Provisional 93.19
PLN0279982 Molybdopterin synthase sulfur carrier subunit 92.64
cd0177180 Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac 92.54
PRK0643767 hypothetical protein; Provisional 92.47
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 92.46
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 92.1
cd0177382 Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i 91.74
KOG0011|consensus340 91.6
cd0075480 MoaD Ubiquitin domain of MoaD-like proteins. MoaD 91.25
PF0056484 PB1: PB1 domain; InterPro: IPR000270 The Phox and 91.15
cd0640886 PB1_NoxR The PB1 domain is present in the Epichloe 91.12
PF12754309 Blt1: Cell-cycle control medial ring component; In 90.22
cd0599281 PB1 The PB1 domain is a modular domain mediating s 89.86
cd0639681 PB1_NBR1 The PB1 domain is an essential part of NB 89.69
PF08337539 Plexin_cytopl: Plexin cytoplasmic RasGAP domain; I 89.63
TIGR02958452 sec_mycoba_snm4 secretion protein snm4. Members of 89.08
PF1483688 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A 87.32
PF1445357 ThiS-like: ThiS-like ubiquitin 86.29
cd0639891 PB1_Joka2 The PB1 domain is present in the Nicotia 85.74
TIGR0168788 moaD_arch MoaD family protein, archaeal. Members o 85.37
TIGR0168280 moaD molybdopterin converting factor, subunit 1, n 85.27
PRK0648865 sulfur carrier protein ThiS; Validated 84.73
cd0640986 PB1_MUG70 The MUG70 protein is a product of the me 84.57
PF0259777 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiam 84.07
cd0056565 ThiS ThiaminS ubiquitin-like sulfur carrier protei 82.88
PF0928059 XPC-binding: XPC-binding domain; InterPro: IPR0153 81.13
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 80.95
KOG2982|consensus418 80.14
>KOG0010|consensus Back     alignment and domain information
Probab=100.00  E-value=1.3e-69  Score=552.44  Aligned_cols=324  Identities=42%  Similarity=0.666  Sum_probs=268.0

Q ss_pred             ceEEEEEEcCCCeEEEEeCCCCcHHHHHHHHHHhhCCCcCCeEEEeCCeecCCCCCcccCCCCCCCeEecccCcccccCC
Q psy11489         11 KLITIVVKTPKEKQNIEIEEDASVTDFKEAVAKKFNALPEQLCLIFAGKIMKDHENLSNHNMKDGLTSLKQLPLTKEIMH   90 (433)
Q Consensus        11 ~~i~V~VKt~~~~~~i~V~~~~TV~~LK~~I~~~~~ip~~~qrLIf~GkiLkD~~tLs~~gI~dg~tV~~~~~~~~~~~~   90 (433)
                      +.|+|+||+.++|++|.|..+.||++||++|+.++++++|++||||+||||||++||..|||+||+||            
T Consensus        14 ~~irV~Vkt~~dk~~~~V~~~ssV~qlKE~I~~~f~a~~dqlvLIfaGrILKD~dTL~~~gI~Dg~Tv------------   81 (493)
T KOG0010|consen   14 SLIRVTVKTPKDKYEVNVASDSSVLQLKELIAQRFGAPPDQLVLIYAGRILKDDDTLKQYGIQDGHTV------------   81 (493)
T ss_pred             ceeEEEEecCCcceeEecccchHHHHHHHHHHHhcCCChhHeeeeecCccccChhhHHHcCCCCCcEE------------
Confidence            46999999999999999999999999999999999999999999999999999999999999999999            


Q ss_pred             CCCCCcccccceeeEeeccCCCCCCC-------CCCC-------------CCCCccCCccccCCCCCCcCCCCCCCchhH
Q psy11489         91 PKEEPTLMSEQLHLVLVRWEVSGICH-------HENL-------------SNHNMKDGLTSLKQLPLTKEITHPKEEPIL  150 (433)
Q Consensus        91 ~~~~~~~~~~~~~lv~~~~~~~~~~~-------~~~p-------------~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~  150 (433)
                                  |||+|.+..+..++       .++|             .....+++++|++..|....          
T Consensus        82 ------------HLVik~~~~~~~~~t~ap~~t~~~P~~~st~~~a~~~p~~l~~~~~~~g~~~~~~~~~----------  139 (493)
T KOG0010|consen   82 ------------HLVIKSQPRPTGTATSAPSSTASTPNNISTGRSASSNPFSLLTVGGFAGLSSLGLFAA----------  139 (493)
T ss_pred             ------------EEEeccCCCCCCccccccccccCCCCCCCCcccccCCcccccccccccccccCCcchh----------
Confidence                        99999875543211       1111             11122334455444444332          


Q ss_pred             HHHHHHHHHHHHHHHHh-hcc--HHHHHh-cCChHHHhhhcCHHHHHHHHHHHHHHHHHHhhCCccc-ccccCccccccC
Q psy11489        151 MSEQLHLVLVRWEAQMQ-QML--PQFLQQ-MQNPEIQGMMANPEALSAIQQIQAGIEQLRTAAPGME-WNFRNPEINHML  225 (433)
Q Consensus       151 ~~~~~~~~~~~~~~~~~-~~~--P~~~~q-m~nP~~q~ll~NP~~l~~~~q~~~~~~~~i~~nP~l~-~~~~nPel~~~l  225 (433)
                             .|.+.+.+++ +..  |+++.+ |+||.||++|+||++||++          |.+||+++ +|++|||++|++
T Consensus       140 -------~F~~l~~~~q~~~~snpe~~~~~m~nP~vq~ll~Npd~mrq~----------I~anPqmq~lm~~npei~h~l  202 (493)
T KOG0010|consen  140 -------MFGELQSQMQNQLLSNPEALRQMMENPIVQSLLNNPDLMRQL----------IMANPQMQDLMQRNPEIGHLL  202 (493)
T ss_pred             -------hcccccccchhccccCHHHHHHhhhChHHHHHhcChHHHHHH----------HhcCHHHHHHHhhCCcchhhh
Confidence                   4555554454 333  999999 9999999999999999999          99999999 999999999999


Q ss_pred             CCHHHHHHHHHHhhChHHHHHHHHHhHHHHhcCcCCCCCcchhhhhhhhhhhHHHHhhhhhccCCCCCCCCCCCCCCCCC
Q psy11489        226 NNPELLRQTMEMARNPSMLQELMRTQDRALSNLESIPGGYSALQRMYRDIQEPMLNAATQQFSRNPYESNSSGGNPGRVK  305 (433)
Q Consensus       226 ~nPe~lrq~~~~~~nP~~~qe~~r~~d~al~~le~~PGG~n~l~~m~~~iq~pm~~a~~~~~~~np~a~~~~~~~~~~~~  305 (433)
                      +||+.+||++|++|||+++||+||++||+|+++|++|||||+|+|||+||||||+|+++++|++|||+++.++.+++...
T Consensus       203 n~p~i~rQtle~arNP~m~qemmrn~d~a~SnlesiPgG~n~l~~my~diqdPm~Na~~~~~g~Npfasl~~~~~s~~~~  282 (493)
T KOG0010|consen  203 NNPLILRQTLESARNPEMMQEMMRNQDRAMSNLESIPGGYNALRRMYTDIQDPMLNAASEQFGGNPFASLPGNQGSGTGG  282 (493)
T ss_pred             cChHHHHHHHHhccCHHHHHHHHhhccccccChhcCccHHHHHHHHhhhccchhhhhcccccCCCCcccccCccccCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999997766544334


Q ss_pred             CCCCCCcCCCCCCCCCCCCCC--------CCCCCC------------CCC------------------------------
Q psy11489        306 APFRRSKRYLGPRQCARPSSS--------LSTPGL------------ANN------------------------------  335 (433)
Q Consensus       306 ~p~~~~n~~~lpnp~~~~~~~--------~~~~g~------------~~~------------------------------  335 (433)
                      .+.. ||+.|+||||+.....        ..+.|.            +..                              
T Consensus       283 ~~~~-eN~~plPn~~~~~~~~s~~a~~~~~~t~G~~s~~~~~n~s~~~~~~~~a~lq~i~~n~~~~~~l~s~~~~~m~~~  361 (493)
T KOG0010|consen  283 SPSP-ENNSPLPNPWAQASTTSSPAANPTPGTSGGTSSNGNSNPSQLGSPGMQAGLQMITENPSLLQQLLSPYIRSMFQS  361 (493)
T ss_pred             CCCc-ccCCCCCCcccCCCCCCCCCCCCCcCccCccccCCCCCccccCCcchhhhhhccccChhhhhhccchhhHHHHhh
Confidence            4455 8999999999863111        000110            000                              


Q ss_pred             ---CC---------------------------------------------------------------------------
Q psy11489        336 ---QG---------------------------------------------------------------------------  337 (433)
Q Consensus       336 ---~~---------------------------------------------------------------------------  337 (433)
                         .+                                                                           
T Consensus       362 ~s~~P~~a~~~~~mq~p~~~~~~~np~a~~ai~qiqq~~~~~~~~a~~l~~~~s~~~~~~n~~p~~~~~~~~~~~~~~~~  441 (493)
T KOG0010|consen  362 ASQNPLQAAQLRQMQNPDVLRAMSNPRAMQAIRQIQQGLQTLAREAPGLVPGQSGASGPINGSPTLLMQLFGSLMLQGLR  441 (493)
T ss_pred             hccCchhhhccccccCchHhhhhcChHHHHHHHHHHHHHHHHHhhccccccccccccCCCCCCchhhhhhhhhhhhhhcc
Confidence               00                                                                           


Q ss_pred             --CCCCCCchhhhHHHHHHhhhcCCCchhhhhhccccCCcchHHHHHhhhc
Q psy11489        338 --GNAQAPPEVRYRSQLDQLTAMGFVNREANLQGSLFGNAGMQSMMQQMMA  386 (433)
Q Consensus       338 --~~~~~~pe~~y~~QL~qL~~mGf~d~~~Nl~al~~~~g~~~~a~~~l~~  386 (433)
                        ....++||+||++||+||++|||.|+++|++|++.++|++++++++|+.
T Consensus       442 ~~n~~~~~pe~r~q~QLeQL~~MGF~nre~nlqAL~atgGdi~aAverll~  492 (493)
T KOG0010|consen  442 GSNQQTVPPEERYQTQLEQLNDMGFLDREANLQALRATGGDINAAVERLLG  492 (493)
T ss_pred             ccCcCCCCchHHHHHHHHHHHhcCCccHHHHHHHHHHhcCcHHHHHHHHhc
Confidence              0145689999999999999999999999999999999999999999874



>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>KOG0011|consensus Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>KOG0005|consensus Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>KOG0003|consensus Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>KOG0004|consensus Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>KOG4248|consensus Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information
>KOG0001|consensus Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>KOG1872|consensus Back     alignment and domain information
>KOG0010|consensus Back     alignment and domain information
>KOG0006|consensus Back     alignment and domain information
>KOG3493|consensus Back     alignment and domain information
>KOG1769|consensus Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi Back     alignment and domain information
>cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 Back     alignment and domain information
>KOG4583|consensus Back     alignment and domain information
>KOG4495|consensus Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>COG5417 Uncharacterized small protein [Function unknown] Back     alignment and domain information
>smart00727 STI1 Heat shock chaperonin-binding motif Back     alignment and domain information
>KOG3206|consensus Back     alignment and domain information
>COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>KOG0012|consensus Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>KOG1639|consensus Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>smart00727 STI1 Heat shock chaperonin-binding motif Back     alignment and domain information
>KOG0013|consensus Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>PF13019 Telomere_Sde2: Telomere stability and silencing Back     alignment and domain information
>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain Back     alignment and domain information
>PF15044 CLU_N: Mitochondrial function, CLU-N-term Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information
>PRK08364 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PLN02799 Molybdopterin synthase sulfur carrier subunit Back     alignment and domain information
>cd01771 Faf1_UBX Faf1 UBX domain Back     alignment and domain information
>PRK06437 hypothetical protein; Provisional Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain Back     alignment and domain information
>KOG0011|consensus Back     alignment and domain information
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins Back     alignment and domain information
>PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins Back     alignment and domain information
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA Back     alignment and domain information
>PF12754 Blt1: Cell-cycle control medial ring component; InterPro: IPR024737 During size-dependent cell cycle transitions controlled by the ubiquitous cyclin-dependent kinase Cdk1, Blt1 has been shown to co-localise with Cdr2 in the medial interphase nodes, as well as with Mid1 which was previously shown to localise to similar interphase structures Back     alignment and domain information
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity Back     alignment and domain information
>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62 Back     alignment and domain information
>PF08337 Plexin_cytopl: Plexin cytoplasmic RasGAP domain; InterPro: IPR013548 This domain is found at C terminus of various plexins (e Back     alignment and domain information
>TIGR02958 sec_mycoba_snm4 secretion protein snm4 Back     alignment and domain information
>PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A Back     alignment and domain information
>PF14453 ThiS-like: ThiS-like ubiquitin Back     alignment and domain information
>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein Back     alignment and domain information
>TIGR01687 moaD_arch MoaD family protein, archaeal Back     alignment and domain information
>TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal Back     alignment and domain information
>PRK06488 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain Back     alignment and domain information
>PF02597 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiaminS) is a 66 aa protein involved in sulphur transfer Back     alignment and domain information
>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein Back     alignment and domain information
>PF09280 XPC-binding: XPC-binding domain; InterPro: IPR015360 Members of this entry adopt a structure consisting of four alpha helices, arranged in an array Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query433
1j8c_A125 Solution Structure Of The Ubiquitin-Like Domain Of 3e-15
2klc_A101 Nmr Solution Structure Of Human Ubiquitin-Like Doma 3e-13
1yqb_A100 Human Ubiquilin 3 Length = 100 9e-12
1wx7_A106 Solution Structure Of The N-Terminal Ubiquitin-Like 4e-11
1wx8_A96 Solution Structure Of The N-Terminal Ubiquitin-Like 1e-06
2jy5_A52 Nmr Structure Of Ubiquilin 1 Uba Domain Length = 52 6e-05
2knz_A53 Nmr Structure Of Cip75 Uba Domain Length = 53 1e-04
>pdb|1J8C|A Chain A, Solution Structure Of The Ubiquitin-Like Domain Of Hplic-2 Length = 125 Back     alignment and structure

Iteration: 1

Score = 79.7 bits (195), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 36/69 (52%), Positives = 50/69 (72%) Query: 9 EKKLITIVVKTPKEKQNIEIEEDASVTDFKEAVAKKFNALPEQLCLIFAGKIMKDHENLS 68 E K+I + VKTPKEK+ + E++SV FKEA++K+F + +QL LIFAGKI+KD + L Sbjct: 29 EPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLI 88 Query: 69 NHNMKDGLT 77 H + DGLT Sbjct: 89 QHGIHDGLT 97
>pdb|2KLC|A Chain A, Nmr Solution Structure Of Human Ubiquitin-Like Domain Of Ubiquilin 1, Northeast Structural Genomics Consortium (Nesg) Target Ht5a Length = 101 Back     alignment and structure
>pdb|1YQB|A Chain A, Human Ubiquilin 3 Length = 100 Back     alignment and structure
>pdb|1WX7|A Chain A, Solution Structure Of The N-Terminal Ubiquitin-Like Domain In The Human Ubiquilin 3 (Ubqln3) Length = 106 Back     alignment and structure
>pdb|1WX8|A Chain A, Solution Structure Of The N-Terminal Ubiquitin-Like Domain In The 4931431f19rik Protein Length = 96 Back     alignment and structure
>pdb|2JY5|A Chain A, Nmr Structure Of Ubiquilin 1 Uba Domain Length = 52 Back     alignment and structure
>pdb|2KNZ|A Chain A, Nmr Structure Of Cip75 Uba Domain Length = 53 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query433
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 4e-24
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 9e-24
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 3e-23
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 1e-22
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 7e-21
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 2e-19
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 9e-19
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 2e-16
3m62_B106 UV excision repair protein RAD23; armadillo-like r 2e-15
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 2e-13
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 1e-12
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 1e-11
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 5e-11
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 5e-11
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 6e-11
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 2e-10
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 3e-10
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 9e-10
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 1e-09
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 2e-09
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 2e-09
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 3e-09
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 3e-09
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 3e-09
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 5e-09
3u5c_F225 RP14, S2, YS8, 40S ribosomal protein S5; translati 6e-09
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 9e-09
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 1e-08
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 2e-08
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 2e-08
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 3e-08
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 3e-08
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 3e-08
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 3e-08
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 3e-08
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 4e-08
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 4e-08
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 4e-08
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 5e-08
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 6e-08
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 7e-08
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 7e-08
2dna_A67 Unnamed protein product; ubiquitin associated doma 1e-07
1we6_A111 Splicing factor, putative; structural genomics, ub 2e-07
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 2e-07
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 3e-07
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 6e-07
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 9e-07
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 2e-06
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 2e-06
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 2e-06
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 3e-06
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 7e-06
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 1e-05
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 2e-05
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 2e-05
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 2e-05
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 4e-05
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 6e-05
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 6e-05
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 1e-04
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 3e-04
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 4e-04
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 7e-04
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
 Score = 94.8 bits (236), Expect = 4e-24
 Identities = 24/74 (32%), Positives = 45/74 (60%)

Query: 4  AQQESEKKLITIVVKTPKEKQNIEIEEDASVTDFKEAVAKKFNALPEQLCLIFAGKIMKD 63
          + +E   ++I + VKTP++     + E+++V  FK+ ++K  +   ++L LIF GKI++D
Sbjct: 9  SGREPSSRIIRVSVKTPQDCHEFFLAENSNVRRFKKQISKYLHCNADRLVLIFTGKILRD 68

Query: 64 HENLSNHNMKDGLT 77
           + LS   + DG T
Sbjct: 69 QDILSQRGILDGST 82


>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 125 Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Length = 77 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Length = 85 Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 106 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 94 Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Length = 88 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Length = 90 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 93 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320 Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Length = 85 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Length = 368 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Length = 79 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Length = 76 Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Length = 76 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 87 Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Length = 58 Back     alignment and structure
>3u5c_F RP14, S2, YS8, 40S ribosomal protein S5; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_F 3o30_D 3o2z_D 3u5g_F 3jyv_G* 2noq_F 1s1h_G 3iz6_F Length = 225 Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Length = 90 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Length = 107 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: k.45.1.1 PDB: 3dbr_I 3dbl_I Length = 88 Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Length = 53 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 78 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 89 Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Length = 128 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Length = 52 Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Length = 46 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Length = 74 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Length = 189 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Length = 88 Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Length = 67 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Length = 111 Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 54 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Length = 84 Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Length = 100 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} Length = 85 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 85 Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Length = 93 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Length = 76 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Length = 88 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Length = 98 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Length = 114 Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Length = 115 Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Length = 96 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Length = 111 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 102 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Length = 159 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Length = 159 Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Length = 169 Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Length = 189 Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 105 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query433
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 99.76
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 99.75
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 99.74
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 99.74
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 99.73
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 99.71
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 99.71
3v6c_B91 Ubiquitin; structural genomics, structural genomic 99.71
3m62_B106 UV excision repair protein RAD23; armadillo-like r 99.7
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 99.69
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 99.68
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 99.68
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 99.68
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 99.68
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 99.68
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 99.68
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 99.68
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 99.68
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 99.68
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 99.67
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 99.67
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 99.67
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 99.67
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 99.67
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 99.67
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 99.67
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 99.66
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 99.66
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 99.66
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 99.66
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 99.66
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 99.65
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 99.65
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 99.65
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 99.65
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 99.65
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 99.65
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 99.65
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 99.64
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 99.64
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 99.63
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 99.63
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 99.63
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 99.63
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 99.63
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 99.63
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 99.63
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 99.63
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 99.62
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 99.62
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 99.6
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 99.6
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 99.6
1we6_A111 Splicing factor, putative; structural genomics, ub 99.6
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 99.59
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 99.58
2fnj_B118 Transcription elongation factor B polypeptide 2; b 99.58
4ajy_B118 Transcription elongation factor B polypeptide 2; E 99.57
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 99.57
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 99.56
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 99.34
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 99.56
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.53
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 99.52
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 99.52
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 99.52
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 99.52
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 99.51
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.51
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 99.5
2kj6_A97 Tubulin folding cofactor B; methods development, N 99.49
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 99.49
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 99.49
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 99.49
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 99.49
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.47
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 99.47
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 99.45
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.45
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.44
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.43
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 99.39
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 99.39
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 99.39
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 99.38
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 99.33
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 99.31
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 99.21
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 99.19
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 99.18
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 99.18
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 99.18
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 99.16
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 99.14
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 99.09
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 99.06
2dna_A67 Unnamed protein product; ubiquitin associated doma 99.05
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 98.93
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 98.89
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 98.86
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 98.81
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 98.79
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 98.75
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 98.74
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 98.66
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 98.63
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 98.62
2pjh_A80 Protein NPL4, nuclear protein localization protein 98.51
2cwb_A108 Chimera of immunoglobulin G binding protein G and 98.49
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 98.39
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 98.32
3v7o_A227 Minor nucleoprotein VP30; ssgcid, seattle structur 98.18
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 98.12
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 98.05
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 97.98
4efo_A94 Serine/threonine-protein kinase TBK1; ubiquitin li 97.97
3ix6_A360 TS, tsase, thymidylate synthase; niaid, ssgcid, se 97.86
4da1_A389 Protein phosphatase 1K, mitochondrial; metal-ION-a 97.63
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 97.17
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 97.16
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 97.11
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 96.84
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 96.59
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 96.52
4e71_A111 Plexin-B2, MM1; transmembrane, signaling, RBD, str 96.46
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 96.19
2r2o_A138 Plexin-B1; effector domain, structural genomics, s 96.14
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 95.95
2lnm_A62 Protein TIC 40, chloroplastic; translocon, import, 95.89
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 95.66
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 95.52
1ryj_A70 Unknown; beta/alpha protein, structural genomics, 95.47
3h6n_A127 Plexin-D1; structural genomics consortium, SGC, me 95.37
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 95.37
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 95.3
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 95.26
4e74_A117 Plexin-A4; RBD, structural genomics, structural ge 95.18
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 95.09
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 94.98
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 94.88
1wji_A63 Tudor domain containing protein 3; UBA domain, str 94.61
2llw_A71 Heat shock protein STI1; DP domain, alpha helix, c 94.5
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 94.44
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 94.21
2lnm_A62 Protein TIC 40, chloroplastic; translocon, import, 94.19
2llw_A71 Heat shock protein STI1; DP domain, alpha helix, c 94.08
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 94.02
2daj_A91 KIAA0977 protein, COBL-like 1; ubiquitin-like doma 93.85
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 93.66
3kuz_A126 Plexin-C1; structural genomics, structural genomic 93.62
2l32_A74 Small archaeal modifier protein 2; protein BIN; NM 93.35
1vjk_A98 Molybdopterin converting factor, subunit 1; struct 93.27
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 93.1
3hm6_X644 Plexin-B1; structural genomics consortium, SGC, me 92.97
1vd2_A89 Protein kinase C, IOTA type; PB1 domain, OPCA moti 92.97
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 92.71
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 92.63
3rpf_C74 Molybdopterin converting factor, subunit 1 (MOAD); 92.33
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 92.28
3ig3_A627 Plxna3 protein; plexin intracellular GAP RBD inact 92.1
3po0_A89 Small archaeal modifier protein 1; ubiquitin-like 91.48
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 90.67
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 90.58
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 90.49
1ip9_A85 BEM1 protein; ubiquitin alpha/beta roll, signaling 90.4
2llv_A71 Heat shock protein STI1; DP domain, alpha helix, c 90.06
2qsf_X 171 RAD23, UV excision repair protein RAD23; alpha-bet 89.82
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 89.42
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 87.88
1q02_A52 Sequestosome 1; helical bundle, protein binding; N 87.44
1pve_A72 HHR23B, UV excision repair protein RAD23 homolog B 86.84
2f4m_B61 UV excision repair protein RAD23 homolog B; glycop 86.79
1fm0_D81 Molybdopterin convertin factor, subunit 1; molybde 86.3
2llv_A71 Heat shock protein STI1; DP domain, alpha helix, c 86.2
2kvr_A130 Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi 84.99
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 84.75
2q5w_D77 Molybdopterin converting factor, subunit 1; MOCO, 84.61
2c7h_A86 RBBP6, retinoblastoma-binding protein 6, isoform 3 84.58
1tyg_B87 YJBS; alpha beta barrel, protein-protein complex, 83.42
2qjl_A99 URM1, ubiquitin-related modifier 1; ubiquitin-like 82.66
1wgy_A104 RAP guanine nucleotide exchange factor 5; ubiquiti 82.66
2g1e_A90 Hypothetical protein TA0895; MOAD, molybdopterin, 82.19
1rws_A77 Hypothetical protein PF1061; residual dipolar coup 81.65
2l52_A99 Methanosarcina acetivorans SAMP1 homolog; beta-grA 81.48
2hj1_A97 Hypothetical protein; structural genomics, PSI, pr 81.13
2juo_A89 GA-binding protein alpha chain; OST, ubiquitin, tr 81.07
3dwg_C93 9.5 kDa culture filtrate antigen CFP10A; sulfur ca 80.93
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
Probab=99.76  E-value=1.8e-17  Score=168.30  Aligned_cols=69  Identities=25%  Similarity=0.316  Sum_probs=63.5

Q ss_pred             CceEEEEEEcCC-CeEEEEeCCCCcHHHHHHHHHH---hhCCCcCCeEEEeCCeecCCCCCcccCCCCCCCeE
Q psy11489         10 KKLITIVVKTPK-EKQNIEIEEDASVTDFKEAVAK---KFNALPEQLCLIFAGKIMKDHENLSNHNMKDGLTS   78 (433)
Q Consensus        10 ~~~i~V~VKt~~-~~~~i~V~~~~TV~~LK~~I~~---~~~ip~~~qrLIf~GkiLkD~~tLs~~gI~dg~tV   78 (433)
                      +..|+|+||+.+ ++|+|+|++++||.+||++|++   +.++++++|||||+||+|+|+++|++|+|++|++|
T Consensus         5 ~~~M~I~VKtl~Gk~~~leV~~~~TV~~LK~~I~~~~~~~gip~~~QrLiy~GK~L~D~~tL~dygI~~gstI   77 (368)
T 1oqy_A            5 SSAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFV   77 (368)
T ss_dssp             -CCCCEEEEETTTEEEEECCCTTCBHHHHHHHHHHHTCSSSCCSTEEEEESSSSEECSSSBTTTTCCCTTSCE
T ss_pred             CceEEEEEEeCCCCEEEEEeCCCChHHHHHHHHHHHhCcCCCChhheEEEECCeecCCcCCHHHcCCCCCCEE
Confidence            456999999974 5799999999999999999999   56799999999999999999999999999999987



>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>4e71_A Plexin-B2, MM1; transmembrane, signaling, RBD, structural genomics consortium, SGC, signaling protein; 2.26A {Homo sapiens} Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>2r2o_A Plexin-B1; effector domain, structural genomics, structural GEN consortium, SGC, glycoprotein, membrane, phosphorylation, R secreted, transmembrane; 2.00A {Homo sapiens} PDB: 2rex_A* 2jph_A Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2lnm_A Protein TIC 40, chloroplastic; translocon, import, TIC40-NP, protein transport; NMR {Arabidopsis thaliana} Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 Back     alignment and structure
>3h6n_A Plexin-D1; structural genomics consortium, SGC, membrane, transmembrane, receptor, alternative splicing, cell membrane, glycoprotein, polymorphism; 2.00A {Homo sapiens} Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>4e74_A Plexin-A4; RBD, structural genomics, structural genomics consor SGC, signaling protein; 1.58A {Homo sapiens} PDB: 3q3j_A* Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2llw_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2lnm_A Protein TIC 40, chloroplastic; translocon, import, TIC40-NP, protein transport; NMR {Arabidopsis thaliana} Back     alignment and structure
>2llw_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>3kuz_A Plexin-C1; structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} Back     alignment and structure
>1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>3hm6_X Plexin-B1; structural genomics consortium, SGC, membrane, transmembrane receptor, cell membrane, glycoprotein, phosphoprotein; 2.40A {Homo sapiens} PDB: 3sua_D* 3su8_X* Back     alignment and structure
>1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3ig3_A Plxna3 protein; plexin intracellular GAP RBD inactive, membrane, transmembra membrane protein, signaling protein; 1.99A {Mus musculus} PDB: 3ryt_A* Back     alignment and structure
>3po0_A Small archaeal modifier protein 1; ubiquitin-like protein, protein binding; 1.55A {Haloferax volcanii} PDB: 2l83_A Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1ip9_A BEM1 protein; ubiquitin alpha/beta roll, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 1ipg_A 2kfk_A Back     alignment and structure
>2llv_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>1q02_A Sequestosome 1; helical bundle, protein binding; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 2jy7_A 2jy8_A 2k0b_X 2knv_A 2rru_A 3b0f_A Back     alignment and structure
>1pve_A HHR23B, UV excision repair protein RAD23 homolog B; XPC binding domain, solution structure, nucleotide excision repair, chaps, DNA binding protein; NMR {Homo sapiens} SCOP: a.189.1.1 Back     alignment and structure
>2f4m_B UV excision repair protein RAD23 homolog B; glycoproteins, ubiquitin-dependent protein degradation, NUCL excision repair, peptide:N-glycanase; 1.85A {Mus musculus} SCOP: a.189.1.1 PDB: 2f4o_B* Back     alignment and structure
>1fm0_D Molybdopterin convertin factor, subunit 1; molybdenum cofactor biosynthesis, transferase; 1.45A {Escherichia coli} SCOP: d.15.3.1 PDB: 1fma_D 1jw9_D 1jwa_D* 1jwb_D* 3bii_D 1nvi_D Back     alignment and structure
>2llv_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>2q5w_D Molybdopterin converting factor, subunit 1; MOCO, MPT synthase, MOAD, MOAE, transferase, molybdenum cofactor biosynthesis; 2.00A {Staphylococcus aureus} PDB: 2qie_B* Back     alignment and structure
>2c7h_A RBBP6, retinoblastoma-binding protein 6, isoform 3; P53-associated, mRNA processing, splicing-associated, oesophageal cancer; NMR {Homo sapiens} Back     alignment and structure
>1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 Back     alignment and structure
>2qjl_A URM1, ubiquitin-related modifier 1; ubiquitin-like protein, signaling protein; 1.44A {Saccharomyces cerevisiae} PDB: 2pko_A 2ax5_A Back     alignment and structure
>1wgy_A RAP guanine nucleotide exchange factor 5; ubiquitin fold, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>2g1e_A Hypothetical protein TA0895; MOAD, molybdopterin, transferase; NMR {Thermoplasma acidophilum} PDB: 2k22_A Back     alignment and structure
>1rws_A Hypothetical protein PF1061; residual dipolar couplings, structural genomics, unknown FUN; NMR {Pyrococcus furiosus} SCOP: d.15.3.2 PDB: 1sf0_A Back     alignment and structure
>2l52_A Methanosarcina acetivorans SAMP1 homolog; beta-grAsp fold, protein binding, E1-like, SAMP activator, ELSA, adenylation, ubiquitin; NMR {Methanosarcina acetivorans} Back     alignment and structure
>2hj1_A Hypothetical protein; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; 2.10A {Haemophilus influenzae} SCOP: d.15.3.4 Back     alignment and structure
>2juo_A GA-binding protein alpha chain; OST, ubiquitin, transcription factor, ensemble, DNA-binding, nucleus, transcription regulation; NMR {Mus musculus} Back     alignment and structure
>3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 433
d2bwfa173 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc 6e-15
d1j8ca_103 d.15.1.1 (A:) Ubiquitin-like N-terminal domain of 5e-13
d1wx8a183 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus muscul 3e-12
d1v86a_95 d.15.1.1 (A:) hypothetical D7wsu128e protein {Mous 1e-11
d1x1ma194 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse 4e-11
d1wgda_93 d.15.1.1 (A:) Homocysteine-responsive endoplasmic 8e-11
d1v5ta_90 d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus mu 3e-10
d1yqba184 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapien 4e-10
d1z2ma276 d.15.1.1 (A:79-154) Interferon-induced 15 kDa prot 1e-09
d1wxva181 d.15.1.1 (A:7-87) Bag-family molecular chaperone r 1e-09
d1zkha186 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-t 1e-09
d1euvb_79 d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yea 3e-09
d1v2ya_105 d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik 4e-09
d1wx9a173 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 5e-09
d1oqya477 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 h 5e-09
d1wgga_96 d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolas 2e-08
d2faza176 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING fing 2e-08
d1bt0a_73 d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis t 3e-08
d1uh6a_100 d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mous 4e-08
d1wh3a_87 d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like 4e-08
d1wy8a176 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING fing 4e-08
d1se9a_101 d.15.1.1 (A:) Hypothetical protein At3g01050 {Thal 7e-08
d2c9wb1103 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) 1e-07
d2dnaa150 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {M 2e-07
d1v6ea_95 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 3e-07
d1wjua_100 d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human 3e-07
d2uyzb177 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human 4e-07
d1z2ma176 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protei 6e-07
d2bwba144 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharom 7e-07
d1wgha_116 d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mous 2e-06
d2zeqa178 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin 2e-06
d1veja161 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculu 2e-06
d1uela_95 d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homol 3e-06
d1ttna180 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquit 4e-06
d1wiaa_95 d.15.1.1 (A:) Ubiquitin-like protein bab25500 (201 8e-06
d1t0ya_90 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 9e-06
d1v5oa_102 d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus mu 2e-05
d1wjna_97 d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse 5e-05
d1we6a_111 d.15.1.1 (A:) Splicing factor 3 subunit 1, C-termi 2e-04
d2daha141 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) 4e-04
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: DSK2
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 67.1 bits (164), Expect = 6e-15
 Identities = 18/65 (27%), Positives = 40/65 (61%)

Query: 13 ITIVVKTPKEKQNIEIEEDASVTDFKEAVAKKFNALPEQLCLIFAGKIMKDHENLSNHNM 72
          + I +K+ ++K  + +  +++V  FKEA+ K          LI++GKI+KD + + ++++
Sbjct: 2  LNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHI 61

Query: 73 KDGLT 77
          +DG +
Sbjct: 62 QDGHS 66


>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 83 Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Length = 79 Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 105 Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 101 Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 44 Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 116 Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 61 Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 90 Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 111 Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query433
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.79
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.79
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 99.77
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 99.76
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 99.75
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 99.74
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 99.74
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 99.73
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 99.73
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 99.72
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 99.72
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 99.72
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 99.71
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 99.7
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 99.7
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 99.69
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 99.68
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 99.68
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 99.68
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 99.67
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 99.67
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 99.66
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 99.66
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 99.65
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 99.64
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 99.64
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 99.63
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 99.62
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 99.62
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 99.61
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 99.54
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 99.5
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 99.45
d2dnaa150 Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus 99.38
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 99.37
d2bwba144 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.34
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 99.32
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 99.24
d1veja161 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.24
d2daha141 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 98.99
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 98.61
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 98.55
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 96.94
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 96.68
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 96.39
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 96.11
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 95.8
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 95.75
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 95.36
d1vjka_88 Molybdopterin synthase subunit MoaD {Pyrococcus fu 95.09
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 95.01
d1ip9a_85 Bud emergence mediator Bemp1 {Baker's yeast (Sacch 94.94
d2cp8a141 Migration-inducing protein 19 NBR1 {Human (Homo sa 94.81
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 93.7
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sap 93.65
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 93.52
d1whca_64 UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta 90.79
d2crna151 Suppressor of T-cell receptor signaling 2 (STS-2) 89.35
d1xo3a_101 C9orf74 homolog {Mouse (Mus musculus) [TaxId: 1009 88.84
d1wgya_104 Rap guanine nucleotide exchange factor 5, RapGEF5 86.5
d1veka_84 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 83.85
d1wgra_100 Growth factor receptor-bound protein 7, GRB-7 {Hum 83.27
d2bkfa185 Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Hum 81.7
d1ef1a384 Moesin {Human (Homo sapiens) [TaxId: 9606]} 81.36
d2f4mb158 XPC-binding domain of Rad23 homolog B (Hhr23b) {Hu 80.49
d1oeya_82 Neutrophil cytosol factor 2 (p67phox component of 80.34
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: DSK2
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.79  E-value=1.2e-19  Score=141.52  Aligned_cols=67  Identities=27%  Similarity=0.489  Sum_probs=65.3

Q ss_pred             eEEEEEEcCCCeEEEEeCCCCcHHHHHHHHHHhhCCCcCCeEEEeCCeecCCCCCcccCCCCCCCeE
Q psy11489         12 LITIVVKTPKEKQNIEIEEDASVTDFKEAVAKKFNALPEQLCLIFAGKIMKDHENLSNHNMKDGLTS   78 (433)
Q Consensus        12 ~i~V~VKt~~~~~~i~V~~~~TV~~LK~~I~~~~~ip~~~qrLIf~GkiLkD~~tLs~~gI~dg~tV   78 (433)
                      +|+|+||+.+++++|+|++++||.+||++|++++|+|+++|||||+||+|+|+.+|++|+|++|++|
T Consensus         1 si~I~Vk~~~~~~~i~v~~~~tV~~lK~~I~~~~gip~~~qrLi~~Gk~L~D~~tL~~~~I~~g~~i   67 (73)
T d2bwfa1           1 SLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSV   67 (73)
T ss_dssp             EEEEEEEETTEEEEEEECTTCBHHHHHHHHHHHHCCCGGGEEEEETTEECCTTSBTGGGTCCTTCEE
T ss_pred             CEEEEEEeCCeEEEEEECCCChHHHHHHHHHHHHCcChHHeEEEECCeEccCCCcHHHCCCCCCCEE
Confidence            4899999988899999999999999999999999999999999999999999999999999999999



>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cp8a1 a.5.2.1 (A:8-48) Migration-inducing protein 19 NBR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgya_ d.15.1.5 (A:) Rap guanine nucleotide exchange factor 5, RapGEF5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bkfa1 d.15.2.2 (A:1-85) Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f4mb1 a.189.1.1 (B:275-332) XPC-binding domain of Rad23 homolog B (Hhr23b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oeya_ d.15.2.2 (A:) Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure