Diaphorina citri psyllid: psy11494


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MRIATGASMVRTELREVTVEEVTAFTDAFNHHIFEMVSANDVNEKKSGIIAIVCLLHVDVGNVNSRNIRFANYLRNLLPSNDIGVMRYAAKTVGKLAQISGTFSAEYADFEMKKAIEWLGGDRVEGKRHAAVLVLKELAVTVPTIFYQHVQAFFDFVFSAVRDPKPEIRLHAVKAIRAALVVTAQRESAKQSQKPQW
ccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHcccccc
****T*ASMVRTELREVTVEEVTAFTDAFNHHIFEMVSANDVNEKKSGIIAIVCLLHVDVGNVNSRNIRFANYLRNLLPSNDIGVMRYAAKTVGKLAQISGTFSAEYADFEMKKAIEWLGGDRVEGKRHAAVLVLKELAVTVPTIFYQHVQAFFDFVFSAVRDPKPEIRLHAVKAIRAALVVT**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIATGASMVRTELREVTVEEVTAFTDAFNHHIFEMVSANDVNEKKSGIIAIVCLLHVDVGNVNSRNIRFANYLRNLLPSNDIGVMRYAAKTVGKLAQISGTFSAEYADFEMKKAIEWLGGDRVEGKRHAAVLVLKELAVTVPTIFYQHVQAFFDFVFSAVRDPKPEIRLHAVKAIRAALVVTAQRESAKQSQKPQW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Target of rapamycin Promotes cell and tissue growth, maintains tissue homeostatis and controls responses to environmental stress and aging. Regulates growth during animal development by coupling growth factor signaling to nutrient availability. Central regulators of autophagy. May be involved in atg1 phosphorylation. May also be involved, directly or indirectly, in the control of neuronal function. Phosphorylates S6K/p70S6K, in vitro. May regulate the activity of S6K. Overexpression inhibits growth and reduces cell size. Affects the timing of neuronal cell differentiation. Hyperactivation of the signaling leads to accelerated differentiation, whereas inhibition of the signaling retards differentiation. Thus, in addition to controlling growth of the cell in which it resides, it can also influence growth of distant cells and organs during development via a humoral mechanism. In short, during development, it primarily controls growth, whereas in the adult, where there is relatively little growth, it controls aging and other aspects of nutrient-related physiology. Rag GTPases act as activators of TORC1 in response to amino acid signals.confidentQ9VK45
Serine/threonine-protein kinase mTOR Serine/threonine protein kinase which is a central regulator of cellular metabolism, growth and survival in response to hormones, growth factors, nutrients, energy and stress signals. Functions as part of 2 structurally and functionally distinct signaling complexes mTORC1 and mTORC2 (mTOR complex 1 and 2). Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. This includes phosphorylation of EIF4EBP1 and release of its inhibition toward the elongation initiation factor 4E (eiF4E). Moreover, phosphorylates and activates RPS6KB1 and RPS6KB2 that promote protein synthesis by modulating the activity of their downstream targets including ribosomal protein S6, eukaryotic translation initiation factor EIF4B and the inhibitor of translation initiation PDCD4. Regulates ribosome synthesis by activating RNA polymerase III-dependent transcription through phosphorylation and inhibition of MAF1 a RNA polymerase III-repressor. In parallel to protein synthesis, also regulates lipid synthesis through SREBF1/SREBP1 and LPIN1. To maintain energy homeostasis mTORC1 may also regulate mitochondrial biogenesis through regulation of PPARGC1A. mTORC1 also negatively regulates autophagy through phosphorylation of ULK1. Under nutrient sufficiency, phosphorylates ULK1 at 'Ser-757', disrupting the interaction with AMPK and preventing activation of ULK1. Also prevents autophagy through phosphorylation of the autophagy inhibitor DAP. mTORC1 exerts a feedback control on upstream growth factor signaling that includes phosphorylation and activation of GRB10 a INSR-dependent signaling suppressor. Among other potential targets mTORC1 may phosphorylate CLIP1 and regulate microtubules. As part of the mTORC2 complex MTOR may regulate other cellular processes including survival and organization of the cytoskeleton. Plays a critical role in the phosphorylation at 'Ser-473' of AKT1, a pro-survival effector of phosphoinositide 3-kinase, facilitating its activation by PDK1. mTORC2 may regulate the actin cytoskeleton, through phosphorylation of PRKCA, PXN and activation of the Rho-type guanine nucleotide exchange factors RHOA and RAC1A or RAC1B. mTORC2 also regulates the phosphorylation of SGK1 at 'Ser-422'.confidentQ9JLN9
Serine/threonine-protein kinase mTOR Serine/threonine protein kinase which is a central regulator of cellular metabolism, growth and survival in response to hormones, growth factors, nutrients, energy and stress signals. Functions as part of 2 structurally and functionally distinct signaling complexes mTORC1 and mTORC2 (mTOR complex 1 and 2). Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. This includes phosphorylation of EIF4EBP1 and release of its inhibition toward the elongation initiation factor 4E (eiF4E). Moreover, phosphorylates and activates RPS6KB1 and RPS6KB2 that promote protein synthesis by modulating the activity of their downstream targets including ribosomal protein S6, eukaryotic translation initiation factor EIF4B and the inhibitor of translation initiation PDCD4. Regulates ribosome synthesis by activating RNA polymerase III-dependent transcription through phosphorylation and inhibition of MAF1 a RNA polymerase III-repressor. In parallel to protein synthesis, also regulates lipid synthesis through SREBF1/SREBP1 and LPIN1. To maintain energy homeostasis mTORC1 may also regulate mitochondrial biogenesis through regulation of PPARGC1A. mTORC1 also negatively regulates autophagy through phosphorylation of ULK1. Under nutrient sufficiency, phosphorylates ULK1 at 'Ser-758', disrupting the interaction with AMPK and preventing activation of ULK1. Also prevents autophagy through phosphorylation of the autophagy inhibitor DAP. mTORC1 exerts a feedback control on upstream growth factor signaling that includes phosphorylation and activation of GRB10 a INSR-dependent signaling suppressor. Among other potential targets mTORC1 may phosphorylate CLIP1 and regulate microtubules. As part of the mTORC2 complex MTOR may regulate other cellular processes including survival and organization of the cytoskeleton. Plays a critical role in the phosphorylation at 'Ser-473' of AKT1, a pro-survival effector of phosphoinositide 3-kinase, facilitating its activation by PDK1. mTORC2 may regulate the actin cytoskeleton, through phosphorylation of PRKCA, PXN and activation of the Rho-type guanine nucleotide exchange factors RHOA and RAC1A or RAC1B. mTORC2 also regulates the phosphorylation of SGK1 at 'Ser-422'.confidentP42345

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043200 [BP]response to amino acid stimulusprobableGO:1901700, GO:0009719, GO:0050896, GO:0010243, GO:0010033, GO:0008150, GO:0001101, GO:0042221, GO:1901698
GO:0051496 [BP]positive regulation of stress fiber assemblyprobableGO:0051130, GO:0032231, GO:0032233, GO:0033043, GO:0051493, GO:0051495, GO:0032970, GO:0010638, GO:0051492, GO:0050794, GO:0044087, GO:0065007, GO:0032956, GO:0048518, GO:0008150, GO:0051128, GO:0050789, GO:0048522
GO:0007281 [BP]germ cell developmentprobableGO:0032502, GO:0044702, GO:0048609, GO:0032504, GO:0022414, GO:0048869, GO:0032501, GO:0030154, GO:0048468, GO:0019953, GO:0044767, GO:0003006, GO:0048610, GO:0044763, GO:0044699, GO:0022412, GO:0008150, GO:0009987, GO:0000003, GO:0007276, GO:0048856
GO:0016605 [CC]PML bodyprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0010646 [BP]regulation of cell communicationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0043022 [MF]ribosome bindingprobableGO:0043021, GO:0003674, GO:0005488
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0070438 [CC]mTOR-FKBP12-rapamycin complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0001558 [BP]regulation of cell growthprobableGO:0040008, GO:0050794, GO:0008150, GO:0065007, GO:0051128, GO:0050789
GO:0018107 [BP]peptidyl-threonine phosphorylationprobableGO:0044267, GO:0006468, GO:0009987, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0018210, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0032456 [BP]endocytic recyclingprobableGO:0016197, GO:0009987, GO:0016192, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0016020 [CC]membraneprobableGO:0005575
GO:0031669 [BP]cellular response to nutrient levelsprobableGO:0031668, GO:0071496, GO:0009605, GO:0050896, GO:0009987, GO:0051716, GO:0031667, GO:0008150, GO:0044763, GO:0044699, GO:0007154, GO:0009991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0001156 [MF]TFIIIC-class transcription factor bindingprobableGO:0001025, GO:0003674, GO:0008134, GO:0005515, GO:0005488
GO:0010592 [BP]positive regulation of lamellipodium assemblyprobableGO:0010591, GO:0051130, GO:0051128, GO:0050789, GO:0044087, GO:0060491, GO:0065007, GO:0048518, GO:0008150, GO:0031346, GO:0031344, GO:0050794, GO:0048522
GO:0043621 [MF]protein self-associationprobableGO:0003674, GO:0005488, GO:0005515
GO:0031529 [BP]ruffle organizationprobableGO:0030030, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0045727 [BP]positive regulation of translationprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010608, GO:0009891, GO:2000112, GO:0051247, GO:0051246, GO:0032270, GO:0048518, GO:0065007, GO:0010468, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0032268, GO:0010557, GO:0010556, GO:0006417, GO:0048522
GO:0016301 [MF]kinase activityprobableGO:0016772, GO:0016740, GO:0003674, GO:0003824
GO:0012505 [CC]endomembrane systemprobableGO:0005575, GO:0044464, GO:0005623
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0071456 [BP]cellular response to hypoxiaprobableGO:0009628, GO:0051716, GO:0070887, GO:0036293, GO:0050896, GO:0009987, GO:0071453, GO:0036294, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0042221, GO:0001666, GO:0044699, GO:0070482
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0031932 [CC]TORC2 complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0001030 [MF]RNA polymerase III type 1 promoter DNA bindingprobableGO:0044212, GO:0080084, GO:0000182, GO:0043565, GO:0001016, GO:0097159, GO:0003677, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0000975, GO:1901363
GO:0001031 [MF]RNA polymerase III type 2 promoter DNA bindingprobableGO:0044212, GO:0001016, GO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0001032 [MF]RNA polymerase III type 3 promoter DNA bindingprobableGO:0044212, GO:0001016, GO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0048583 [BP]regulation of response to stimulusprobableGO:0008150, GO:0065007, GO:0050789
GO:0010628 [BP]positive regulation of gene expressionprobableGO:0009893, GO:0019222, GO:0060255, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0010468, GO:0010604
GO:0032868 [BP]response to insulin stimulusprobableGO:1901700, GO:0009719, GO:0050896, GO:0009725, GO:0010243, GO:1901698, GO:0008150, GO:1901652, GO:0042221, GO:0043434, GO:0010033
GO:0040007 [BP]growthprobableGO:0008150
GO:0001934 [BP]positive regulation of protein phosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0048522

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1U6G, chain C
Confidence level:confident
Coverage over the Query: 22-182
View the alignment between query and template
View the model in PyMOL