Diaphorina citri psyllid: psy11501


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MGTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQK
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccEEEccccccccc
MGTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Multiple epidermal growth factor-like domains protein 10 Membrane receptor involved in phagocytosis. May also regulate homotypic retinal neuron repulsion. May play role in cell adhesion and motility. May also be an essential factor in the regulation of myogenesis, controlling the balance between skeletal muscle satellite cells proliferation and differentiation.confidentA0JM12
Multiple epidermal growth factor-like domains protein 10 Membrane receptor involved in phagocytosis by macrophages of apoptotic cells. Cooperates with ABCA1 within the process of engulfment. Promotes the formation of large intracellular vacuoles and may be responsible for the uptake of amyloid-beta peptides. May also function in the mosaic spacing of specific neuron subtypes in the retina through homotypic retinal neuron repulsion. Mosaics provide a mechanism to distribute each cell type evenly across the retina, ensuring that all parts of the visual field have access to a full set of processing elements. May play role in cell adhesion and motility. Is also an essential factor in the regulation of myogenesis. Controls the balance between skeletal muscle satellite cells proliferation and differentiation problably through regulation of the notch signaling pathway.confidentQ96KG7
Multiple epidermal growth factor-like domains protein 10 Membrane receptor involved in phagocytosis by macrophages of apoptotic cells. Cooperates with ABCA1 within the process of engulfment. Promotes the formation of large intracellular vacuoles and may be responsible for the uptake of amyloid-beta peptides. May also function in the mosaic spacing of specific neuron subtypes in the retina through homotypic retinal neuron repulsion. Mosaics provide a mechanism to distribute each cell type evenly across the retina, ensuring that all parts of the visual field have access to a full set of processing elements. May play role in cell adhesion and motility. Is also an essential factor in the regulation of myogenesis. Controls the balance between skeletal muscle satellite cells proliferation and differentiation problably through regulation of the notch signaling pathway.confidentQ6DIB5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001891 [CC]phagocytic cupprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0070062 [CC]extracellular vesicular exosomeprobableGO:0043230, GO:0031982, GO:0044421, GO:0065010, GO:0031988, GO:0005575, GO:0005576, GO:0043227, GO:0043226
GO:0019219 [BP]regulation of nucleobase-containing compound metabolic processprobableGO:0080090, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0070887 [BP]cellular response to chemical stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0042221, GO:0044699
GO:0014841 [BP]satellite cell proliferationprobableGO:0008150, GO:0044699, GO:0008283
GO:0031253 [CC]cell projection membraneprobableGO:0016020, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0042995, GO:0044459
GO:0097458 [CC]neuron partprobableGO:0005575, GO:0044464, GO:0005623
GO:0009967 [BP]positive regulation of signal transductionprobableGO:0009966, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0005044 [MF]scavenger receptor activityprobableGO:0038024, GO:0003674, GO:0004872
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0048641 [BP]regulation of skeletal muscle tissue developmentprobableGO:1901861, GO:0016202, GO:0050793, GO:0048634, GO:0008150, GO:2000026, GO:0051239, GO:0065007, GO:0050789
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0009719 [BP]response to endogenous stimulusprobableGO:0050896, GO:0008150
GO:0031410 [CC]cytoplasmic vesicleprobableGO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226
GO:0045597 [BP]positive regulation of cell differentiationprobableGO:0051094, GO:0050793, GO:0050794, GO:0045595, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0034109 [BP]homotypic cell-cell adhesionprobableGO:0016337, GO:0009987, GO:0044763, GO:0007155, GO:0008150, GO:0022610, GO:0044699
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0044422 [CC]organelle partprobableGO:0005575, GO:0043226
GO:0031175 [BP]neuron projection developmentprobableGO:0032502, GO:0030030, GO:0030154, GO:0048468, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:1901700 [BP]response to oxygen-containing compoundprobableGO:0042221, GO:0050896, GO:0008150
GO:0034446 [BP]substrate adhesion-dependent cell spreadingprobableGO:0032502, GO:0031589, GO:0000904, GO:0000902, GO:0009653, GO:0048869, GO:0030154, GO:0048468, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0007155, GO:0008150, GO:0009987, GO:0022610, GO:0044699, GO:0048856
GO:0009887 [BP]organ morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0009888 [BP]tissue developmentprobableGO:0032502, GO:0048856, GO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0051147 [BP]regulation of muscle cell differentiationprobableGO:0050793, GO:0050794, GO:0045595, GO:0008150, GO:0065007, GO:0050789
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0030169 [MF]low-density lipoprotein particle bindingprobableGO:0071813, GO:0003674, GO:0071814, GO:0005488
GO:0016049 [BP]cell growthprobableGO:0008150, GO:0009987, GO:0044763, GO:0040007, GO:0044699
GO:0043256 [CC]laminin complexprobableGO:0043234, GO:0005605, GO:0005604, GO:0032991, GO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0033993 [BP]response to lipidprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0006897 [BP]endocytosisprobableGO:0006810, GO:0008150, GO:0016192, GO:0051234, GO:0051179
GO:0016477 [BP]cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0007417 [BP]central nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0010628 [BP]positive regulation of gene expressionprobableGO:0009893, GO:0019222, GO:0060255, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0010468, GO:0010604

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GY5, chain A
Confidence level:very confident
Coverage over the Query: 24-93
View the alignment between query and template
View the model in PyMOL
Template: 2GY5, chain A
Confidence level:very confident
Coverage over the Query: 7-133
View the alignment between query and template
View the model in PyMOL