Psyllid ID: psy11501


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MGTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQK
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccEEEccccccccc
cccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccEEEccccccccc
mgthceevcgpgrfgqncsqecqcrngaechpatgecscqpgftgslceercppgthgpscinrcrcqngaicnpangqclcapgwmgsvcnvpctpgmwgqgctvpcecfngaschhvtgecqcepgfkgqk
mgthceevcgpgrfgqNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGEcqcepgfkgqk
MGTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQK
*******VCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQC********
MGTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKG**
MGTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQK
****CEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGF****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query133 2.2.26 [Sep-21-2011]
A0JM12 1114 Multiple epidermal growth yes N/A 0.977 0.116 0.507 6e-33
Q6DIB5 1147 Multiple epidermal growth yes N/A 0.977 0.113 0.507 7e-33
Q96KG7 1140 Multiple epidermal growth yes N/A 0.646 0.075 0.507 1e-32
A6BM72 1044 Multiple epidermal growth no N/A 0.969 0.123 0.530 2e-32
Q80T91 1091 Multiple epidermal growth no N/A 0.969 0.118 0.530 2e-32
O750951541 Multiple epidermal growth no N/A 0.977 0.084 0.511 5e-27
Q80V70 1572 Multiple epidermal growth no N/A 0.984 0.083 0.469 2e-26
O88281 1574 Multiple epidermal growth no N/A 0.977 0.082 0.465 1e-25
Q5VY43 1037 Platelet endothelial aggr no N/A 0.984 0.126 0.439 1e-23
Q9XWD6 1111 Cell death abnormality pr no N/A 0.992 0.118 0.432 5e-23
>sp|A0JM12|MEG10_XENTR Multiple epidermal growth factor-like domains protein 10 OS=Xenopus tropicalis GN=megf10 PE=2 SV=1 Back     alignment and function desciption
 Score =  139 bits (349), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 67/132 (50%), Positives = 87/132 (65%)

Query: 2   GTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSC 61
           G  CEE C  G +G +C Q+CQC+NGA C   TGEC C PG+TG+ CE+ CPPG HG  C
Sbjct: 174 GWRCEERCDQGTYGNDCQQKCQCQNGASCDHVTGECRCPPGYTGAFCEDLCPPGKHGSQC 233

Query: 62  INRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTG 121
             RC CQNG +C+   G+C C  GWMG+VC  PC  G +G+ C+  C+C NG +C   TG
Sbjct: 234 EERCPCQNGGVCHHVTGECSCPAGWMGTVCGQPCPEGRYGRNCSQECQCHNGGTCDSATG 293

Query: 122 ECQCEPGFKGQK 133
           +C C PG+ G++
Sbjct: 294 QCYCSPGYNGER 305




Membrane receptor involved in phagocytosis. May also regulate homotypic retinal neuron repulsion. May play role in cell adhesion and motility. May also be an essential factor in the regulation of myogenesis, controlling the balance between skeletal muscle satellite cells proliferation and differentiation.
Xenopus tropicalis (taxid: 8364)
>sp|Q6DIB5|MEG10_MOUSE Multiple epidermal growth factor-like domains protein 10 OS=Mus musculus GN=Megf10 PE=1 SV=1 Back     alignment and function description
>sp|Q96KG7|MEG10_HUMAN Multiple epidermal growth factor-like domains protein 10 OS=Homo sapiens GN=MEGF10 PE=1 SV=1 Back     alignment and function description
>sp|A6BM72|MEG11_HUMAN Multiple epidermal growth factor-like domains protein 11 OS=Homo sapiens GN=MEGF11 PE=2 SV=3 Back     alignment and function description
>sp|Q80T91|MEG11_MOUSE Multiple epidermal growth factor-like domains protein 11 OS=Mus musculus GN=Megf11 PE=1 SV=3 Back     alignment and function description
>sp|O75095|MEGF6_HUMAN Multiple epidermal growth factor-like domains protein 6 OS=Homo sapiens GN=MEGF6 PE=1 SV=4 Back     alignment and function description
>sp|Q80V70|MEGF6_MOUSE Multiple epidermal growth factor-like domains protein 6 OS=Mus musculus GN=Megf6 PE=2 SV=3 Back     alignment and function description
>sp|O88281|MEGF6_RAT Multiple epidermal growth factor-like domains protein 6 OS=Rattus norvegicus GN=Megf6 PE=1 SV=1 Back     alignment and function description
>sp|Q5VY43|PEAR1_HUMAN Platelet endothelial aggregation receptor 1 OS=Homo sapiens GN=PEAR1 PE=1 SV=1 Back     alignment and function description
>sp|Q9XWD6|CED1_CAEEL Cell death abnormality protein 1 OS=Caenorhabditis elegans GN=ced-1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query133
383848080 1002 PREDICTED: multiple epidermal growth fac 0.977 0.129 0.548 2e-37
350424059 993 PREDICTED: multiple epidermal growth fac 0.977 0.130 0.541 3e-37
340726359 991 PREDICTED: multiple epidermal growth fac 0.977 0.131 0.541 4e-37
307182743 991 Multiple epidermal growth factor-like do 0.977 0.131 0.548 8e-37
380024321 1001 PREDICTED: multiple epidermal growth fac 0.977 0.129 0.533 2e-36
380024323 990 PREDICTED: multiple epidermal growth fac 0.977 0.131 0.533 2e-36
328779088 967 PREDICTED: draper [Apis mellifera] 0.977 0.134 0.533 2e-36
345495719 1020 PREDICTED: multiple epidermal growth fac 0.984 0.128 0.548 7e-36
307193492 1007 Multiple epidermal growth factor-like do 0.977 0.129 0.533 1e-35
328723650 1000 PREDICTED: multiple epidermal growth fac 0.977 0.13 0.537 2e-34
>gi|383848080|ref|XP_003699680.1| PREDICTED: multiple epidermal growth factor-like domains protein 11-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 73/133 (54%), Positives = 94/133 (70%)

Query: 1   MGTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPS 60
            G +CE+ C P R+GQ+C +EC+CRNG  CH  +GEC C PG+TG LC++ CPPG HG  
Sbjct: 166 TGDYCEQQCSPDRYGQDCGEECRCRNGGSCHHISGECHCAPGYTGPLCDDFCPPGKHGDE 225

Query: 61  CINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVT 120
           C + C+CQNG  CNP  G C CAPGW G VC + C  G WG+ C+  C+C+N ASCHH+T
Sbjct: 226 CKSDCKCQNGGSCNPTTGSCYCAPGWTGIVCALRCPEGFWGKNCSQVCDCYNKASCHHLT 285

Query: 121 GECQCEPGFKGQK 133
           GEC+C+PG+   K
Sbjct: 286 GECECKPGYYDVK 298




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350424059|ref|XP_003493675.1| PREDICTED: multiple epidermal growth factor-like domains protein 10-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340726359|ref|XP_003401527.1| PREDICTED: multiple epidermal growth factor-like domains protein 10-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307182743|gb|EFN69867.1| Multiple epidermal growth factor-like domains 11 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380024321|ref|XP_003695949.1| PREDICTED: multiple epidermal growth factor-like domains protein 10-like isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|380024323|ref|XP_003695950.1| PREDICTED: multiple epidermal growth factor-like domains protein 10-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|328779088|ref|XP_624855.2| PREDICTED: draper [Apis mellifera] Back     alignment and taxonomy information
>gi|345495719|ref|XP_001606322.2| PREDICTED: multiple epidermal growth factor-like domains protein 11-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307193492|gb|EFN76269.1| Multiple epidermal growth factor-like domains 10 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328723650|ref|XP_001942552.2| PREDICTED: multiple epidermal growth factor-like domains protein 10-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query133
UNIPROTKB|F1RKL7305 MEGF10 "Uncharacterized protei 0.984 0.429 0.519 1.5e-44
UNIPROTKB|F1MET4 1136 MEGF10 "Uncharacterized protei 0.992 0.116 0.515 1.1e-43
FB|FBgn0027594 1031 drpr "draper" [Drosophila mela 0.992 0.128 0.515 1.4e-43
UNIPROTKB|A0JM12 1114 megf10 "Multiple epidermal gro 0.992 0.118 0.507 5.7e-43
UNIPROTKB|E1C393 1132 MEGF10 "Uncharacterized protei 0.992 0.116 0.522 7.5e-43
UNIPROTKB|Q96KG7 1140 MEGF10 "Multiple epidermal gro 0.992 0.115 0.507 7.7e-43
UNIPROTKB|F1MAP4 1145 Megf10 "Protein Megf10" [Rattu 0.992 0.115 0.507 7.7e-43
UNIPROTKB|A6BM72 1044 MEGF11 "Multiple epidermal gro 0.992 0.126 0.530 8e-43
MGI|MGI:2685177 1147 Megf10 "multiple EGF-like-doma 0.992 0.115 0.507 9.9e-43
UNIPROTKB|E2RQ32 1150 MEGF10 "Uncharacterized protei 0.992 0.114 0.507 1.3e-42
UNIPROTKB|F1RKL7 MEGF10 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 469 (170.2 bits), Expect = 1.5e-44, P = 1.5e-44
 Identities = 68/131 (51%), Positives = 87/131 (66%)

Query:     2 GTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSC 61
             G  CEE C  G +G +C Q CQC+NGA C   TGEC C PG+TG+ CE+ CPPG HGP C
Sbjct:   175 GWRCEERCEQGTYGNDCHQRCQCQNGATCDHVTGECRCPPGYTGAFCEDLCPPGKHGPQC 234

Query:    62 INRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTG 121
               RC CQNG +C+   G+C C PGW+G+VC  PC  G +G+ C+  C+C NG +C   TG
Sbjct:   235 EQRCPCQNGGVCHHVTGECPCPPGWLGTVCGQPCPEGRFGKNCSQECQCHNGGTCDAATG 294

Query:   122 ECQCEPGFKGQ 132
             +C C PG+ G+
Sbjct:   295 QCHCSPGYTGE 305


GO:0055001 "muscle cell development" evidence=IEA
GO:0051147 "regulation of muscle cell differentiation" evidence=IEA
GO:0048641 "regulation of skeletal muscle tissue development" evidence=IEA
GO:0043654 "recognition of apoptotic cell" evidence=IEA
GO:0034109 "homotypic cell-cell adhesion" evidence=IEA
GO:0014841 "satellite cell proliferation" evidence=IEA
GO:0014816 "satellite cell differentiation" evidence=IEA
GO:0014719 "satellite cell activation" evidence=IEA
GO:0001891 "phagocytic cup" evidence=IEA
UNIPROTKB|F1MET4 MEGF10 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0027594 drpr "draper" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|A0JM12 megf10 "Multiple epidermal growth factor-like domains protein 10" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|E1C393 MEGF10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q96KG7 MEGF10 "Multiple epidermal growth factor-like domains protein 10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAP4 Megf10 "Protein Megf10" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A6BM72 MEGF11 "Multiple epidermal growth factor-like domains protein 11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2685177 Megf10 "multiple EGF-like-domains 10" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQ32 MEGF10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6DIB5MEG10_MOUSENo assigned EC number0.50750.97740.1133yesN/A
Q96KG7MEG10_HUMANNo assigned EC number0.50750.64660.0754yesN/A
A0JM12MEG10_XENTRNo assigned EC number0.50750.97740.1166yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 133
KOG1225|consensus 525 99.46
KOG0994|consensus 1758 99.4
KOG0994|consensus 1758 99.24
KOG4289|consensus 2531 99.12
KOG1219|consensus 4289 99.08
KOG1225|consensus 525 99.0
KOG4289|consensus 2531 98.81
KOG1219|consensus 4289 98.63
KOG1836|consensus 1705 98.59
KOG1226|consensus 783 98.48
KOG1836|consensus 1705 98.27
smart0005163 DSL delta serrate ligand. 98.26
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 98.03
KOG1226|consensus 783 97.9
KOG3512|consensus 592 97.9
KOG1218|consensus 316 97.83
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 97.79
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 97.77
smart0005163 DSL delta serrate ligand. 97.74
KOG4260|consensus350 97.72
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 97.68
KOG1217|consensus 487 97.53
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 97.5
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 97.49
KOG1217|consensus 487 97.3
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.3
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 97.26
KOG1214|consensus 1289 97.22
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 97.18
KOG1218|consensus316 97.11
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 97.09
KOG3512|consensus 592 97.03
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 97.02
PF0000832 EGF: EGF-like domain This is a sub-family of the P 96.74
smart0017939 EGF_CA Calcium-binding EGF-like domain. 95.9
KOG4260|consensus 350 95.86
smart0017939 EGF_CA Calcium-binding EGF-like domain. 95.68
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 95.45
cd0005336 EGF Epidermal growth factor domain, found in epide 95.17
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 95.17
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 94.93
cd0005336 EGF Epidermal growth factor domain, found in epide 94.81
smart0018135 EGF Epidermal growth factor-like domain. 94.54
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 94.49
KOG1214|consensus 1289 94.15
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 92.54
PF0168352 EB: EB module; InterPro: IPR006149 The EB domain h 86.76
PF1266224 cEGF: Complement Clr-like EGF-like 83.74
KOG0196|consensus 996 83.56
KOG0196|consensus 996 82.98
PHA03099139 epidermal growth factor-like protein (EGF-like pro 80.18
>KOG1225|consensus Back     alignment and domain information
Probab=99.46  E-value=5.5e-13  Score=99.81  Aligned_cols=107  Identities=40%  Similarity=1.120  Sum_probs=78.8

Q ss_pred             ccccCCCCCCCCC-CC--CCCCCCEEecCCCeeecCCCCccCCCCc-cCCCCCCCCCCCCCCCCCCCCeecCCCCeeeCC
Q psy11501          8 VCGPGRFGQNCSQ-EC--QCRNGAECHPATGECSCQPGFTGSLCEE-RCPPGTHGPSCINRCRCQNGAICNPANGQCLCA   83 (133)
Q Consensus         8 ~C~~g~~g~~c~~-~C--~C~~~g~C~~~~~~C~C~~g~~G~~C~~-~C~~g~~g~~C~~~~~C~~~~~C~~~~~~C~C~   83 (133)
                      .|..+|+|..|+. .|  .|.+++.|.  .+.|+|++||+|.+|++ .|+.           .|+.++.+.  .++|+|.
T Consensus       237 ~c~~~~~g~~c~~~~C~~~c~~~g~c~--~G~CIC~~Gf~G~dC~e~~Cp~-----------~cs~~g~~~--~g~CiC~  301 (525)
T KOG1225|consen  237 ECPEGYFGPLCSTIYCPGGCTGRGQCV--EGRCICPPGFTGDDCDELVCPV-----------DCSGGGVCV--DGECICN  301 (525)
T ss_pred             ecCCceeCCccccccCCCCCcccceEe--CCeEeCCCCCcCCCCCcccCCc-----------ccCCCceec--CCEeecC
Confidence            6888899988875 36  366677887  67999999999999985 2332           255555554  4588888


Q ss_pred             CCcccCCCCC------------------CCCCCccCCCCCCCCCCCCCCeeccCCCceeCCCCCccCC
Q psy11501         84 PGWMGSVCNV------------------PCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQK  133 (133)
Q Consensus        84 ~g~~g~~c~~------------------~c~~g~~g~~c~~~c~C~~~g~C~~~~g~C~C~~g~~G~~  133 (133)
                      ++|.|..|++                  .|.+||+|..|... .|.+++.|.  ++ |+|..||.|.+
T Consensus       302 ~g~~G~dCs~~~cpadC~g~G~Ci~G~C~C~~Gy~G~~C~~~-~C~~~g~cv--~g-C~C~~Gw~G~d  365 (525)
T KOG1225|consen  302 PGYSGKDCSIRRCPADCSGHGKCIDGECLCDEGYTGELCIQR-ACSGGGQCV--NG-CKCKKGWRGPD  365 (525)
T ss_pred             CCccccccccccCCccCCCCCcccCCceEeCCCCcCCccccc-ccCCCceec--cC-ceeccCccCCC
Confidence            8888887753                  46677777777766 488888884  56 99999998864



>KOG0994|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF01683 EB: EB module; InterPro: IPR006149 The EB domain has no known function Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query133
2gy5_A 423 Tie2 Ligand-Binding Domain Crystal Structure Length 1e-15
>pdb|2GY5|A Chain A, Tie2 Ligand-Binding Domain Crystal Structure Length = 423 Back     alignment and structure

Iteration: 1

Score = 77.8 bits (190), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 53/128 (41%), Positives = 62/128 (48%), Gaps = 6/128 (4%) Query: 9 CGPGRFGQNCSQECQ-CRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRC 67 C ++G C+ C C N CH TGEC C PGF G CE+ C T G +C RC Sbjct: 189 CEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSG 248 Query: 68 QNG----AICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGEC 123 Q G C P C CA GW G CN C PG +G C + C C NG C G C Sbjct: 249 QEGCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQG-C 307 Query: 124 QCEPGFKG 131 C PG++G Sbjct: 308 LCSPGWQG 315

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query133
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 6e-21
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 1e-17
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 2e-14
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 1e-05
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 8e-15
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 3e-14
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 3e-09
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 7e-08
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 2e-05
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 2e-13
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 1e-11
4aqs_A 525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 6e-10
4aqs_A 525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 1e-08
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 4e-08
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 1e-10
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, 2e-09
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 4e-07
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 1e-05
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, 3e-05
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 5e-08
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 8e-07
2ygq_A 324 WIF-1, WNT inhibitory factor 1; signaling protein, 1e-05
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 6e-07
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 7e-07
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 4e-04
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 1e-06
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 2e-04
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 2e-05
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 9e-05
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 3e-05
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 8e-04
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 4e-05
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 1e-04
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 7e-04
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
 Score = 85.9 bits (212), Expect = 6e-21
 Identities = 52/137 (37%), Positives = 63/137 (45%), Gaps = 6/137 (4%)

Query: 1   MGTHCEEVCGPGRFGQNCSQECQ-CRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGP 59
                   C   ++G  C+  C  C N   CH  TGEC C PGF G  CE+ C   T G 
Sbjct: 181 FTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGR 240

Query: 60  SCINRC----RCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGAS 115
           +C  RC     C++   C P    C CA GW G  CN  C PG +G  C + C C NG  
Sbjct: 241 TCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEM 300

Query: 116 CHHVTGECQCEPGFKGQ 132
           C    G C C PG++G 
Sbjct: 301 CDRFQG-CLCSPGWQGL 316


>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query133
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.89
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.75
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.68
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.63
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.61
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.59
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.47
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.43
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.4
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.36
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.33
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.28
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.2
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.19
2bou_A143 EGF-like module containing mucin-like hormone rece 99.14
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.14
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.12
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.12
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.04
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 98.95
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.9
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 98.9
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.86
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.75
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.73
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.67
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.65
2y38_A403 Laminin subunit alpha-5; structural protein, cell 98.61
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 98.6
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.58
2bou_A143 EGF-like module containing mucin-like hormone rece 98.53
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.48
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 98.44
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.32
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.23
2y38_A403 Laminin subunit alpha-5; structural protein, cell 98.15
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.14
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.07
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.06
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.05
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.05
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.03
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.01
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 97.97
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 97.96
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.95
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 97.9
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 97.88
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 97.86
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 97.8
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 97.79
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 97.75
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 97.75
2vh0_B134 Activated factor XA light chain; serine protease, 97.73
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 97.68
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 97.62
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 97.52
2vh0_B134 Activated factor XA light chain; serine protease, 97.47
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 97.47
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 97.46
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.45
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.41
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.39
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 97.31
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.26
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.21
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.13
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.13
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.11
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 97.01
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 97.0
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 96.99
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 96.97
1nql_B53 Epidermal growth factor; cell surface receptor, ty 96.93
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 96.92
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 96.86
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 96.85
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 96.82
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 96.8
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 96.77
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 96.65
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 96.61
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 96.53
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 96.51
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 96.5
2k2s_B61 Micronemal protein 6; microneme protein complex, c 96.47
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 96.19
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 96.1
2k2s_B61 Micronemal protein 6; microneme protein complex, c 96.1
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 95.97
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 95.59
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 95.18
3v65_B 386 Low-density lipoprotein receptor-related protein; 94.55
2i9a_A145 Urokinase-type plasminogen activator; growth facto 94.13
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 93.99
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 93.87
2e26_A 725 Reelin, reeler protein; signaling protein; HET: NA 93.84
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 93.63
3v65_B 386 Low-density lipoprotein receptor-related protein; 93.28
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 93.26
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 93.25
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 93.13
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 92.8
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 92.66
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 92.29
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 92.15
2i9a_A145 Urokinase-type plasminogen activator; growth facto 92.06
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 92.01
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 91.92
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 90.66
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 90.16
3fl7_A 536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 89.59
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 88.89
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 87.83
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 87.09
3fl7_A 536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 86.14
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 85.27
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 83.87
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 83.73
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 80.22
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
Probab=99.89  E-value=2.3e-23  Score=152.80  Aligned_cols=126  Identities=40%  Similarity=1.064  Sum_probs=111.8

Q ss_pred             cccccCCCCCCCCCCC-CCCCCCEEecCCCeeecCCCCccCCCCccCCCCCCCCCCCCC----CCCCCCCeecCCCCeee
Q psy11501          7 EVCGPGRFGQNCSQEC-QCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINR----CRCQNGAICNPANGQCL   81 (133)
Q Consensus         7 ~~C~~g~~g~~c~~~C-~C~~~g~C~~~~~~C~C~~g~~G~~C~~~C~~g~~g~~C~~~----~~C~~~~~C~~~~~~C~   81 (133)
                      ..|++||+|+.|+..| +|.++++|++.+++|.|++||+|..|+..|.++|+|..|...    ..|.+++.|....++|.
T Consensus       187 c~C~~g~~G~~C~~~C~~C~~~G~C~~~~g~C~C~~G~~G~~Ce~~C~~g~~g~~C~~~C~~~~~C~~~g~C~~~~~~C~  266 (423)
T 2gy5_A          187 RRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCS  266 (423)
T ss_dssp             CSSCTTEESTTSCEECCCCCTTCEECTTTCCEECCTTEESTTSCEECCTTEESTTSCEECCSTTTTTTCCEEETTTTEEE
T ss_pred             CcCCCCCCCCCCCCCCCCCCCCCEEECCCCcEeCCCCccCCCcccccCCCCCCCCcCccCCCCCCCCCCCEECCCCCeEE
Confidence            4799999999999888 699999999878999999999999999779999999887643    24777788877789999


Q ss_pred             CCCCcccCCCCCCCCCCccCCCCCCCCCCCCCCeeccCCCceeCCCCCccCC
Q psy11501         82 CAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQK  133 (133)
Q Consensus        82 C~~g~~g~~c~~~c~~g~~g~~c~~~c~C~~~g~C~~~~g~C~C~~g~~G~~  133 (133)
                      |++||.|.+|+..|.+||+|..|+.+|+|.++++|++..+ |.|++||+|.+
T Consensus       267 C~~G~~G~~C~~~C~~G~~G~~C~~~C~C~ngg~C~~~~~-C~C~~G~~G~~  317 (423)
T 2gy5_A          267 CATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQG-CLCSPGWQGLQ  317 (423)
T ss_dssp             CCBTCBSGGGCBCCCTTBCSBTTCCBCCCTTCCEEETTTE-EECCTTCBSTT
T ss_pred             eCCCcccccccCccCCCCcCCcccccccCCCCCEecCCCc-eECCCCCcCCC
Confidence            9999999999977999999999988889999999987665 99999999963



>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query133
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.15
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.1
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.09
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.09
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.07
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.05
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.05
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.02
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.91
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.84
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.83
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.82
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.76
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.7
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.67
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.66
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.63
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.6
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 97.59
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.53
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 97.51
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.41
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.3
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.3
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 97.29
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 97.26
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.24
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.15
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.13
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 97.1
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.06
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 97.02
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 96.97
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 96.76
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 96.7
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 96.69
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 96.68
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 96.66
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 96.38
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 96.36
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 95.87
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 95.75
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 95.74
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 95.27
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 95.1
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 94.61
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 94.41
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 94.18
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 92.87
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 92.22
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 91.88
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 90.34
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 89.96
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 88.29
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 86.51
d1i0ua241 Low density lipoprotein (LDL) receptor, different 85.1
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 81.75
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Factor X, N-terminal module
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.15  E-value=1.2e-06  Score=41.56  Aligned_cols=32  Identities=31%  Similarity=0.828  Sum_probs=27.0

Q ss_pred             CCCCCCCCCCCeecCC--CCeeeCCCCcccCCCCC
Q psy11501         61 CINRCRCQNGAICNPA--NGQCLCAPGWMGSVCNV   93 (133)
Q Consensus        61 C~~~~~C~~~~~C~~~--~~~C~C~~g~~g~~c~~   93 (133)
                      |... ||.++++|.+.  .++|.|++||.|.+|++
T Consensus         3 C~~~-PC~ngg~C~~~~~~y~C~C~~G~~G~~Cei   36 (39)
T d1xkba1           3 CETS-PCQNQGKCKDGLGEYTCTCLEGFEGKNCEL   36 (39)
T ss_dssp             TTTC-CCCSSCEECCCSSSCCEECCTTEETTTTCE
T ss_pred             CCCC-CCCCCcEEECCCCCEEEECCCCCCcCcCeE
Confidence            5443 89999999866  78999999999999974



>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure