Psyllid ID: psy11502


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MEKIHRETLRETNQALVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTDLHVSRSRRMIQAIRRRVFYNKLFLIMIIVIESMTLSVMLYLKIFKKR
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MEKIHRETLRETNQALVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTDLHVSRSRRMIQAIRRRVFYNKLFLIMIIVIESMTLSVMLYLKIFKKR
mekihretlretnqalvrtgesiVRSEQAALEAEaigtgviselgvQREALVRArdrlvdtdlhvsrsrrmiqairrrvfyNKLFLIMIIVIESMTLSVMLYLKIFKKR
MEKIHRETLRETNQALVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTDLHVsrsrrmiqairrrVFYNKLFLIMIIVIESMTLSVMLYLKIFKKR
*****************************ALEAEAIGTGVISELGVQREALVRARDRLVDTDLHVSRSRRMIQAIRRRVFYNKLFLIMIIVIESMTLSVMLYLKIF***
****HRE***********************LEAEAIGTGVISELGVQ***************L*VSRSRRMIQAIRRRVFYNKLFLIMIIVIESMTLSVMLYLKIFKK*
********LRETNQALVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTDLHVSRSRRMIQAIRRRVFYNKLFLIMIIVIESMTLSVMLYLKIFKKR
***IHRETLRETNQALVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTDLHVSRSRRMIQAIRRRVFYNKLFLIMIIVIESMTLSVMLYLKIFKKR
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKIHRETLRETNQALVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTDLHVSRSRRMIQAIRRRVFYNKLFLIMIIVIESMTLSVMLYLKIFKKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query109 2.2.26 [Sep-21-2011]
O88384232 Vesicle transport through yes N/A 0.935 0.439 0.401 1e-13
P58200232 Vesicle transport through yes N/A 0.935 0.439 0.401 1e-13
Q2KIU0232 Vesicle transport through yes N/A 0.944 0.443 0.368 5e-12
Q9UEU0232 Vesicle transport through yes N/A 0.862 0.405 0.404 3e-09
O89116217 Vesicle transport through no N/A 0.917 0.460 0.303 2e-06
Q9LVP9221 Vesicle transport v-SNARE no N/A 0.825 0.407 0.311 1e-05
Q96AJ9217 Vesicle transport through no N/A 0.807 0.405 0.306 2e-05
Q9JI51224 Vesicle transport through yes N/A 0.770 0.375 0.329 3e-05
Q54CK6217 Vesicle transport through yes N/A 0.724 0.364 0.303 0.0001
Q9SEL6221 Vesicle transport v-SNARE no N/A 0.844 0.416 0.293 0.0003
>sp|O88384|VTI1B_MOUSE Vesicle transport through interaction with t-SNAREs homolog 1B OS=Mus musculus GN=Vti1b PE=1 SV=1 Back     alignment and function desciption
 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 68/102 (66%)

Query: 6   RETLRETNQALVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTDLHV 65
           R  L +  ++L R  +SI RS + A E + IGT +I ELG QR+ L R + RLV+T+ ++
Sbjct: 129 RALLLQGTESLNRATQSIERSHRIATETDQIGTEIIEELGEQRDQLERTKSRLVNTNENL 188

Query: 66  SRSRRMIQAIRRRVFYNKLFLIMIIVIESMTLSVMLYLKIFK 107
           S+SR++++++ R+V  NKL L +II++E   L  ++Y K F+
Sbjct: 189 SKSRKILRSMSRKVITNKLLLSVIILLELAILVGLVYYKFFR 230




V-SNARE that mediates vesicle transport pathways through interactions with t-SNAREs on the target membrane. These interactions are proposed to mediate aspects of the specificity of vesicle trafficking and to promote fusion of the lipid bilayers.
Mus musculus (taxid: 10090)
>sp|P58200|VTI1B_RAT Vesicle transport through interaction with t-SNAREs homolog 1B OS=Rattus norvegicus GN=Vti1b PE=1 SV=2 Back     alignment and function description
>sp|Q2KIU0|VTI1B_BOVIN Vesicle transport through interaction with t-SNAREs homolog 1B OS=Bos taurus GN=VTI1B PE=2 SV=1 Back     alignment and function description
>sp|Q9UEU0|VTI1B_HUMAN Vesicle transport through interaction with t-SNAREs homolog 1B OS=Homo sapiens GN=VTI1B PE=1 SV=3 Back     alignment and function description
>sp|O89116|VTI1A_MOUSE Vesicle transport through interaction with t-SNAREs homolog 1A OS=Mus musculus GN=Vti1a PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP9|VTI13_ARATH Vesicle transport v-SNARE 13 OS=Arabidopsis thaliana GN=VTI13 PE=2 SV=1 Back     alignment and function description
>sp|Q96AJ9|VTI1A_HUMAN Vesicle transport through interaction with t-SNAREs homolog 1A OS=Homo sapiens GN=VTI1A PE=1 SV=2 Back     alignment and function description
>sp|Q9JI51|VTI1A_RAT Vesicle transport through interaction with t-SNAREs homolog 1A OS=Rattus norvegicus GN=Vti1a PE=1 SV=1 Back     alignment and function description
>sp|Q54CK6|VTI1A_DICDI Vesicle transport through interaction with t-SNAREs homolog 1A OS=Dictyostelium discoideum GN=vti1A PE=1 SV=1 Back     alignment and function description
>sp|Q9SEL6|VTI11_ARATH Vesicle transport v-SNARE 11 OS=Arabidopsis thaliana GN=VTI11 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
321479332 227 hypothetical protein DAPPUDRAFT_299903 [ 0.908 0.436 0.494 1e-17
405973002181 Vesicle transport through interaction wi 0.981 0.591 0.457 4e-17
312372523112 hypothetical protein AND_30241 [Anophele 0.917 0.892 0.48 3e-16
443693796 222 hypothetical protein CAPTEDRAFT_161960 [ 0.990 0.486 0.416 7e-16
346469721 227 hypothetical protein [Amblyomma maculatu 0.954 0.458 0.451 2e-15
41054742 225 vesicle transport through interaction wi 0.954 0.462 0.451 2e-15
383858688113 PREDICTED: vesicle transport through int 0.972 0.938 0.490 8e-15
348515987 226 PREDICTED: vesicle transport through int 0.862 0.415 0.478 8e-15
410925598 224 PREDICTED: vesicle transport through int 0.972 0.473 0.433 9e-15
118783148111 AGAP003112-PA [Anopheles gambiae str. PE 0.935 0.918 0.460 2e-14
>gi|321479332|gb|EFX90288.1| hypothetical protein DAPPUDRAFT_299903 [Daphnia pulex] Back     alignment and taxonomy information
 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 68/99 (68%)

Query: 8   TLRETNQALVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTDLHVSR 67
           T+R+    L RT +S+ R+ Q ALE+E IGTGVI EL  QRE LVR RDRL +TD  + R
Sbjct: 128 TVRQGTAILERTSQSLYRTTQVALESEDIGTGVIQELSQQREVLVRTRDRLTETDAELGR 187

Query: 68  SRRMIQAIRRRVFYNKLFLIMIIVIESMTLSVMLYLKIF 106
           SRR+++++ R    NKL LI+II++E   L+ ++Y K F
Sbjct: 188 SRRILKSMSRVAMTNKLVLIVIILLEICILTGLVYYKFF 226




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|405973002|gb|EKC37742.1| Vesicle transport through interaction with t-SNAREs-like protein 1B [Crassostrea gigas] Back     alignment and taxonomy information
>gi|312372523|gb|EFR20467.1| hypothetical protein AND_30241 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|443693796|gb|ELT95070.1| hypothetical protein CAPTEDRAFT_161960 [Capitella teleta] Back     alignment and taxonomy information
>gi|346469721|gb|AEO34705.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|41054742|ref|NP_957330.1| vesicle transport through interaction with t-SNAREs homolog 1B [Danio rerio] gi|32766295|gb|AAH55131.1| Vesicle transport through interaction with t-SNAREs homolog 1B (yeast) [Danio rerio] Back     alignment and taxonomy information
>gi|383858688|ref|XP_003704831.1| PREDICTED: vesicle transport through interaction with t-SNAREs homolog 1B-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|348515987|ref|XP_003445521.1| PREDICTED: vesicle transport through interaction with t-SNAREs homolog 1B-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|410925598|ref|XP_003976267.1| PREDICTED: vesicle transport through interaction with t-SNAREs homolog 1B-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|118783148|ref|XP_312794.3| AGAP003112-PA [Anopheles gambiae str. PEST] gi|116129074|gb|EAA08377.3| AGAP003112-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
ZFIN|ZDB-GENE-040426-1148225 vti1b "vesicle transport throu 0.944 0.457 0.388 5.6e-13
UNIPROTKB|E1BUX5232 VTI1B "Uncharacterized protein 0.954 0.448 0.365 3.9e-12
MGI|MGI:1855688232 Vti1b "vesicle transport throu 0.935 0.439 0.362 3.5e-11
RGD|1560475232 RGD1560475 "similar to vesicle 0.935 0.439 0.362 4.5e-11
UNIPROTKB|P58200232 Vti1b "Vesicle transport throu 0.935 0.439 0.362 4.5e-11
UNIPROTKB|Q9UEU0232 VTI1B "Vesicle transport throu 0.935 0.439 0.352 1.2e-10
UNIPROTKB|F1N1Z0232 VTI1B "Vesicle transport throu 0.944 0.443 0.339 1.5e-10
UNIPROTKB|F1SA25232 VTI1B "Uncharacterized protein 0.944 0.443 0.339 2e-10
UNIPROTKB|Q2KIU0232 VTI1B "Vesicle transport throu 0.944 0.443 0.330 7.7e-10
RGD|2323682231 LOC100359512 "vesicle transpor 0.935 0.441 0.333 1.2e-08
ZFIN|ZDB-GENE-040426-1148 vti1b "vesicle transport through interaction with t-SNAREs homolog 1B (yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 171 (65.3 bits), Expect = 5.6e-13, P = 5.6e-13
 Identities = 40/103 (38%), Positives = 58/103 (56%)

Query:     6 RETLRETNQALVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTDLHV 65
             R  L +  ++L    +SI RS++ A E + IGT +I ELG QRE L R RDRLV+T  ++
Sbjct:   123 RALLIQGTESLNNASKSIERSQRIAAETDQIGTDIIEELGEQREQLDRTRDRLVNTGENL 182

Query:    66 XXXXXXXXXXXXXVFYNKLFLIMIIVIESMTLSVMLYLKIFKK 108
                          +  NKL L +II++E   L  ++YLK F+K
Sbjct:   183 SRSRKILRAMSRRIVTNKLLLSIIIIMEVAILGGVVYLKFFRK 225




GO:0016020 "membrane" evidence=IEA
GO:0016192 "vesicle-mediated transport" evidence=IEA
GO:0006886 "intracellular protein transport" evidence=IEA
UNIPROTKB|E1BUX5 VTI1B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1855688 Vti1b "vesicle transport through interaction with t-SNAREs 1B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1560475 RGD1560475 "similar to vesicle transport through interaction with t-SNAREs 1B homolog" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P58200 Vti1b "Vesicle transport through interaction with t-SNAREs homolog 1B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UEU0 VTI1B "Vesicle transport through interaction with t-SNAREs homolog 1B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N1Z0 VTI1B "Vesicle transport through interaction with t-SNAREs homolog 1B" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SA25 VTI1B "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIU0 VTI1B "Vesicle transport through interaction with t-SNAREs homolog 1B" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|2323682 LOC100359512 "vesicle transport through interaction with t-SNAREs 1B-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
pfam1235266 pfam12352, V-SNARE_C, Snare region anchored in the 1e-07
>gnl|CDD|152787 pfam12352, V-SNARE_C, Snare region anchored in the vesicle membrane C-terminus Back     alignment and domain information
 Score = 44.9 bits (107), Expect = 1e-07
 Identities = 22/66 (33%), Positives = 38/66 (57%)

Query: 14 QALVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTDLHVSRSRRMIQ 73
          + L+R  + +  S + A E  +IG  ++ +L  QRE L RAR++L +TD  + +S   ++
Sbjct: 1  ERLLREHDRLKNSHRIADETISIGQAILEDLHSQRETLKRARNKLHNTDNRLGKSNSTLR 60

Query: 74 AIRRRV 79
           I RR 
Sbjct: 61 LINRRR 66


Within the SNARE proteins interactions in the C-terminal half of the SNARE helix are critical to the driving of membrane fusion; whereas interactions in the N-terminal half of the SNARE domain are important for promoting priming or docking of the vesicle pfam05008. Length = 66

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 109
KOG1666|consensus220 100.0
PF1235266 V-SNARE_C: Snare region anchored in the vesicle me 99.7
PF0390892 Sec20: Sec20; InterPro: IPR005606 Sec20 is a membr 99.54
KOG3251|consensus213 99.53
KOG3208|consensus231 98.82
KOG0812|consensus311 98.51
KOG3065|consensus 273 98.39
PF0095789 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 98.32
smart0039766 t_SNARE Helical region found in SNAREs. All alpha- 98.07
KOG3202|consensus235 97.87
KOG0860|consensus116 97.81
COG5074280 t-SNARE complex subunit, syntaxin [Intracellular t 97.53
KOG0810|consensus297 97.37
PF0573963 SNARE: SNARE domain; InterPro: IPR000727 The proce 97.37
PF09753251 Use1: Membrane fusion protein Use1; InterPro: IPR0 97.29
KOG0811|consensus269 97.29
COG5325283 t-SNARE complex subunit, syntaxin [Intracellular t 97.24
PRK10884206 SH3 domain-containing protein; Provisional 97.19
KOG3385|consensus118 97.07
KOG2678|consensus244 97.04
KOG3894|consensus316 97.02
cd0019360 t_SNARE Soluble NSF (N-ethylmaleimide-sensitive fu 97.02
KOG0809|consensus305 95.43
PF0095789 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 95.17
PRK0102677 tetrahydromethanopterin S-methyltransferase subuni 95.11
PF0421070 MtrG: Tetrahydromethanopterin S-methyltransferase, 95.02
TIGR0114970 mtrG N5-methyltetrahydromethanopterin:coenzyme M m 94.02
PF1291156 OppC_N: N-terminal TM domain of oligopeptide trans 93.1
COG406475 MtrG Tetrahydromethanopterin S-methyltransferase, 92.91
KOG3065|consensus273 92.88
PF0988959 DUF2116: Uncharacterized protein containing a Zn-r 92.28
KOG0859|consensus217 90.54
PF07423 217 DUF1510: Protein of unknown function (DUF1510); In 89.65
PRK10132108 hypothetical protein; Provisional 89.47
PF1266958 P12: Virus attachment protein p12 family 88.83
PHA03240258 envelope glycoprotein M; Provisional 87.58
PF0811443 PMP1_2: ATPase proteolipid family; InterPro: IPR01 87.53
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 87.24
PF04678180 DUF607: Protein of unknown function, DUF607; Inter 87.13
KOG0862|consensus216 87.08
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 86.22
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 85.94
PF05283186 MGC-24: Multi-glycosylated core protein 24 (MGC-24 85.71
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 85.59
PHA0284475 putative transmembrane protein; Provisional 84.82
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 84.67
PHA0265081 hypothetical protein; Provisional 84.36
PF00523490 Fusion_gly: Fusion glycoprotein F0; InterPro: IPR0 84.26
PF0988959 DUF2116: Uncharacterized protein containing a Zn-r 83.66
PTZ00464211 SNF-7-like protein; Provisional 83.61
PF10151 469 DUF2359: Uncharacterised conserved protein (DUF235 82.95
PF14283218 DUF4366: Domain of unknown function (DUF4366) 81.22
PF1235266 V-SNARE_C: Snare region anchored in the vesicle me 80.76
>KOG1666|consensus Back     alignment and domain information
Probab=100.00  E-value=1.6e-32  Score=198.00  Aligned_cols=105  Identities=33%  Similarity=0.539  Sum_probs=103.6

Q ss_pred             chHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHhhhHhhhHHHHHHHHHHHHHHHHHHHh
Q psy11502          2 EKIHRETLRETNQALVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTDLHVSRSRRMIQAIRRRVFY   81 (109)
Q Consensus         2 ~~~~R~~ll~~~~~l~~t~~~L~~s~~~~~ete~iG~~il~~L~~Qre~L~~~~~~~~~i~~~l~~a~~~l~~m~rr~~~   81 (109)
                      +.+||.+||+|++++++++++|.+|+|++.|||+||.+|+++|+.|||+|+++++.+.++|+++++|+++|+.|.||+++
T Consensus       116 ~~dQR~rLl~nTerLeRst~rl~ds~Ria~ETEqIG~~IL~dL~~QRe~L~rar~rL~~td~~lgkS~kiL~tM~RR~~~  195 (220)
T KOG1666|consen  116 SADQRARLLQNTERLERSTDRLKDSQRIALETEQIGSEILEDLHGQREQLERARERLRETDANLGKSRKILTTMTRRLIR  195 (220)
T ss_pred             chhHHHHHHhhhHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchhhhhHHHHHHHHHHHHHHH
Confidence            67999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHh
Q psy11502         82 NKLFLIMIIVIESMTLSVMLYLKIF  106 (109)
Q Consensus        82 ~K~il~~ii~~l~l~i~~viy~k~~  106 (109)
                      |||++++||++++++|++++|+||+
T Consensus       196 nk~~~~aii~~l~~~il~ilY~kf~  220 (220)
T KOG1666|consen  196 NKFTLTAIIALLVLAILLILYSKFT  220 (220)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            9999999999999999999999995



>PF12352 V-SNARE_C: Snare region anchored in the vesicle membrane C-terminus; PDB: 1GL2_C 2NPS_C Back     alignment and domain information
>PF03908 Sec20: Sec20; InterPro: IPR005606 Sec20 is a membrane glycoprotein associated with secretory pathway Back     alignment and domain information
>KOG3251|consensus Back     alignment and domain information
>KOG3208|consensus Back     alignment and domain information
>KOG0812|consensus Back     alignment and domain information
>KOG3065|consensus Back     alignment and domain information
>PF00957 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 Synaptobrevin is an intrinsic membrane protein of small synaptic vesicles [], specialised secretory organelles of neurons that actively accumulate neurotransmitters and participate in their calcium-dependent release by exocytosis Back     alignment and domain information
>smart00397 t_SNARE Helical region found in SNAREs Back     alignment and domain information
>KOG3202|consensus Back     alignment and domain information
>KOG0860|consensus Back     alignment and domain information
>COG5074 t-SNARE complex subunit, syntaxin [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0810|consensus Back     alignment and domain information
>PF05739 SNARE: SNARE domain; InterPro: IPR000727 The process of vesicular fusion with target membranes depends on a set of SNAREs (SNAP-Receptors), which are associated with the fusing membranes [, ] Back     alignment and domain information
>PF09753 Use1: Membrane fusion protein Use1; InterPro: IPR019150 This entry represents a family of proteins, approximately 300 residues in length, involved in vesicle transport Back     alignment and domain information
>KOG0811|consensus Back     alignment and domain information
>COG5325 t-SNARE complex subunit, syntaxin [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>KOG3385|consensus Back     alignment and domain information
>KOG2678|consensus Back     alignment and domain information
>KOG3894|consensus Back     alignment and domain information
>cd00193 t_SNARE Soluble NSF (N-ethylmaleimide-sensitive fusion protein)-Attachment protein (SNAP) REceptor domain; these alpha-helical motifs form twisted and parallel heterotetrameric helix bundles; the core complex contains one helix from a protein that is anchored in the vesicle membrane (synaptobrevin), one helix from a protein of the target membrane (syntaxin), and two helices from another protein anchored in the target membrane (SNAP-25); their interaction forms a core which is composed of a polar zero layer, a flanking leucine-zipper layer acts as a water tight shield to isolate ionic interactions in the zero layer from the surrounding solvent Back     alignment and domain information
>KOG0809|consensus Back     alignment and domain information
>PF00957 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 Synaptobrevin is an intrinsic membrane protein of small synaptic vesicles [], specialised secretory organelles of neurons that actively accumulate neurotransmitters and participate in their calcium-dependent release by exocytosis Back     alignment and domain information
>PRK01026 tetrahydromethanopterin S-methyltransferase subunit G; Provisional Back     alignment and domain information
>PF04210 MtrG: Tetrahydromethanopterin S-methyltransferase, subunit G ; InterPro: IPR005866 This model describes the N5-methyltetrahydromethanopterin: coenzyme M methyltransferase subunit G in methanogenic archaea Back     alignment and domain information
>TIGR01149 mtrG N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit G Back     alignment and domain information
>PF12911 OppC_N: N-terminal TM domain of oligopeptide transport permease C Back     alignment and domain information
>COG4064 MtrG Tetrahydromethanopterin S-methyltransferase, subunit G [Coenzyme metabolism] Back     alignment and domain information
>KOG3065|consensus Back     alignment and domain information
>PF09889 DUF2116: Uncharacterized protein containing a Zn-ribbon (DUF2116); InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown Back     alignment and domain information
>KOG0859|consensus Back     alignment and domain information
>PF07423 DUF1510: Protein of unknown function (DUF1510); InterPro: IPR009988 This family consists of several hypothetical bacterial proteins of around 200 residues in length Back     alignment and domain information
>PRK10132 hypothetical protein; Provisional Back     alignment and domain information
>PF12669 P12: Virus attachment protein p12 family Back     alignment and domain information
>PHA03240 envelope glycoprotein M; Provisional Back     alignment and domain information
>PF08114 PMP1_2: ATPase proteolipid family; InterPro: IPR012589 This family consists of small proteolipids associated with the plasma membrane H+ ATPase Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>PF04678 DUF607: Protein of unknown function, DUF607; InterPro: IPR006769 This entry represents the C-terminal domain of coiled-coil domain containing protein 109 Back     alignment and domain information
>KOG0862|consensus Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PF05283 MGC-24: Multi-glycosylated core protein 24 (MGC-24); InterPro: IPR007947 CD164 is a mucin-like receptor, or sialomucin, with specificity in receptor/ ligand interactions that depends on the structural characteristics of the mucin-like receptor Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>PHA02844 putative transmembrane protein; Provisional Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>PHA02650 hypothetical protein; Provisional Back     alignment and domain information
>PF00523 Fusion_gly: Fusion glycoprotein F0; InterPro: IPR000776 The fusion glycoproteins from this family are found in ssRNA negative-strand viruses Back     alignment and domain information
>PF09889 DUF2116: Uncharacterized protein containing a Zn-ribbon (DUF2116); InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown Back     alignment and domain information
>PTZ00464 SNF-7-like protein; Provisional Back     alignment and domain information
>PF10151 DUF2359: Uncharacterised conserved protein (DUF2359); InterPro: IPR019308 This is a 450 amino acid region of a family of proteins conserved from insects to humans Back     alignment and domain information
>PF14283 DUF4366: Domain of unknown function (DUF4366) Back     alignment and domain information
>PF12352 V-SNARE_C: Snare region anchored in the vesicle membrane C-terminus; PDB: 1GL2_C 2NPS_C Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
1gl2_C65 Crystal Structure Of An Endosomal Snare Core Comple 4e-05
>pdb|1GL2|C Chain C, Crystal Structure Of An Endosomal Snare Core Complex Length = 65 Back     alignment and structure

Iteration: 1

Score = 43.1 bits (100), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 22/47 (46%), Positives = 31/47 (65%) Query: 16 LVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTD 62 + R +SI RS + A E + IGT +I ELG QR+ L R + RLV+T+ Sbjct: 4 MNRATQSIERSHRIATETDQIGTEIIEELGEQRDQLERTKSRLVNTN 50

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
2nps_C81 Vesicle transport through interaction with T- snar 2e-15
1gl2_C65 VTI1B, vesicle transport V-snare protein VTI1-like 4e-13
>2nps_C Vesicle transport through interaction with T- snares homolog 1A; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Rattus norvegicus} Length = 81 Back     alignment and structure
 Score = 64.4 bits (157), Expect = 2e-15
 Identities = 25/79 (31%), Positives = 43/79 (54%)

Query: 5  HRETLRETNQALVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTDLH 64
           R  L +  + L R+   +    Q A+E E IG  ++  L   RE + RAR+RL +TD +
Sbjct: 3  MRAHLLDNTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDRERIQRARERLRETDAN 62

Query: 65 VSRSRRMIQAIRRRVFYNK 83
          + +S R++  + RR+  N+
Sbjct: 63 LGKSSRILTGMLRRIIQNR 81


>1gl2_C VTI1B, vesicle transport V-snare protein VTI1-like 1; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Mus musculus} SCOP: h.1.15.1 Length = 65 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
2nps_C81 Vesicle transport through interaction with T- snar 99.93
1gl2_C65 VTI1B, vesicle transport V-snare protein VTI1-like 99.81
1n7s_C79 SNAP-25A; neuronal snare protein complex, four hel 99.69
1nhl_A54 Synaptosomal-associated protein 23; snare, coiled- 99.49
3b5n_C70 Protein transport protein SEC9; snare complex, syn 99.23
1l4a_C83 S-SNAP25 fusion protein; snare, snare complex, mem 99.21
3hd7_B109 Syntaxin-1A; membrane protein, coiled-coil, 4-heli 98.41
3hd7_A91 Vesicle-associated membrane protein 2; membrane pr 98.2
2kog_A119 Vesicle-associated membrane protein 2; synaptobrev 97.3
3hd7_A91 Vesicle-associated membrane protein 2; membrane pr 97.27
3b5n_D64 Protein transport protein SEC9; snare complex, syn 96.76
2nps_D82 Syntaxin-6; vesicle fusion, snare complex, early e 96.65
1sfc_D87 Protein (SNAP-25B), protein (synaptobrevin 2); mem 96.62
1gl2_D65 Syntaxin 8, vesicle transport V-snare protein VTI1 96.62
1n7s_D66 SNAP-25A; neuronal snare protein complex, four hel 96.42
1l4a_D87 S-SNAP25 fusion protein; snare, snare complex, mem 96.16
1jth_B77 Syntaxin 1A; coiled-coil, polar layer, endocytosis 93.27
2nps_B71 Syntaxin 13, vesicle-associated membrane protein 4 90.18
1gl2_B65 Syntaxin 7; membrane protein, membrane fusion prot 89.94
3b5n_B69 Protein SSO1; snare complex, syntaxin, synaptobrev 89.22
1n7s_B68 Syntaxin 1A; neuronal snare protein complex, four 88.01
2kog_A119 Vesicle-associated membrane protein 2; synaptobrev 86.83
3ljc_A252 ATP-dependent protease LA; LON N-domain, allosteri 83.72
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 82.8
1sfc_B83 Protein (syntaxin 1A), protein (synaptobrevin 2); 82.45
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 80.4
1sfc_A96 VAMP 2, protein (synaptobrevin 2); membrane fusion 80.2
>2nps_C Vesicle transport through interaction with T- snares homolog 1A; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Rattus norvegicus} Back     alignment and structure
Probab=99.93  E-value=4.3e-26  Score=143.28  Aligned_cols=80  Identities=31%  Similarity=0.514  Sum_probs=77.1

Q ss_pred             HHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHhhhHhhhHHHHHHHHHHHHHHHHHHHhhH
Q psy11502          4 IHRETLRETNQALVRTGESIVRSEQAALEAEAIGTGVISELGVQREALVRARDRLVDTDLHVSRSRRMIQAIRRRVFYNK   83 (109)
Q Consensus         4 ~~R~~ll~~~~~l~~t~~~L~~s~~~~~ete~iG~~il~~L~~Qre~L~~~~~~~~~i~~~l~~a~~~l~~m~rr~~~~K   83 (109)
                      +||++||++++++++++++|.+|++++.|||++|.+|+++|+.|||+|.+++++++++|+++++|+++|+.|.||+++||
T Consensus         2 ~qR~~Ll~~t~~L~rt~~~L~~s~r~~~ETE~iG~~il~~L~~QRE~l~~~~~~l~~~d~~l~~s~k~l~~M~rr~~~nK   81 (81)
T 2nps_C            2 SMRAHLLDNTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDRERIQRARERLRETDANLGKSSRILTGMLRRIIQNR   81 (81)
T ss_dssp             TTTTHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTC--
T ss_pred             cHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHhHHhHHHHHHHHHHHHHHHHHhCC
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999987



>1gl2_C VTI1B, vesicle transport V-snare protein VTI1-like 1; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Mus musculus} SCOP: h.1.15.1 Back     alignment and structure
>1n7s_C SNAP-25A; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1sfc_C 1urq_C 3hd7_C* 3hd9_C 3ipd_C 3rk2_C 3rk3_C 3rl0_C 1kil_C 1jth_A Back     alignment and structure
>1nhl_A Synaptosomal-associated protein 23; snare, coiled-coil, protein transport; 2.30A {Homo sapiens} SCOP: h.1.15.1 Back     alignment and structure
>3b5n_C Protein transport protein SEC9; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 Back     alignment and structure
>1l4a_C S-SNAP25 fusion protein; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 Back     alignment and structure
>3hd7_B Syntaxin-1A; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_B 3ipd_B Back     alignment and structure
>3hd7_A Vesicle-associated membrane protein 2; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_A 3ipd_A Back     alignment and structure
>2kog_A Vesicle-associated membrane protein 2; synaptobrevin, VAMP2, DPC micelle, snare, coiled coil, membrane fusion, transmembrane; NMR {Rattus norvegicus} Back     alignment and structure
>3hd7_A Vesicle-associated membrane protein 2; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_A 3ipd_A Back     alignment and structure
>3b5n_D Protein transport protein SEC9; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2nps_D Syntaxin-6; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Homo sapiens} Back     alignment and structure
>1sfc_D Protein (SNAP-25B), protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>1gl2_D Syntaxin 8, vesicle transport V-snare protein VTI1-like 1; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>1n7s_D SNAP-25A; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 3rk2_D 3rk3_D 3rl0_D 1kil_D 3hd7_D* 3hd9_D 3ipd_D 1urq_D 1xtg_B Back     alignment and structure
>1l4a_D S-SNAP25 fusion protein; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 Back     alignment and structure
>1jth_B Syntaxin 1A; coiled-coil, polar layer, endocytosis-exocytosis complex; 2.00A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1hvv_A* 1urq_B Back     alignment and structure
>2nps_B Syntaxin 13, vesicle-associated membrane protein 4; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Rattus norvegicus} Back     alignment and structure
>1gl2_B Syntaxin 7; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Mus musculus} SCOP: h.1.15.1 Back     alignment and structure
>3b5n_B Protein SSO1; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 Back     alignment and structure
>1n7s_B Syntaxin 1A; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 3rk2_B 3rk3_B 3rl0_B 1kil_B Back     alignment and structure
>2kog_A Vesicle-associated membrane protein 2; synaptobrevin, VAMP2, DPC micelle, snare, coiled coil, membrane fusion, transmembrane; NMR {Rattus norvegicus} Back     alignment and structure
>3ljc_A ATP-dependent protease LA; LON N-domain, allosteric enzyme, ATP-binding, DNA-binding, H nucleotide-binding, serine protease, stress respo; 2.60A {Escherichia coli} Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>1sfc_B Protein (syntaxin 1A), protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1l4a_B Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>1sfc_A VAMP 2, protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00