Diaphorina citri psyllid: psy11503


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
LGNVPVSEASVVIAISSPHRQTALSAVEHAINKLKEMAPIWKKEEYAPGTHTDAQWKENSECMWRVVSLHYEAYKSMALKVFKDICNNLRETWPDIVNVAIYHRLGNVPVSEASVVIAISSPHRQTALSAVEHAINKLKEMAPIWKKEEYAPGTHTDAQWKENSECMWRVKH
cccccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccccEEEEEEEcccHHHHHHHHHHHHHHHcccccccccECccccccccccccccccHHHHHcc
LGNVPVSEASVVIAISSPHRQTALSAVEHAINKLKEMAPIWKKEEYAPGTHTDAQWKENSECMWRVVSLHYEAYKSMALKVFKDICNNLRETWPDIVNVAIYHRLGNVPVSEASVVIAISSPHRQTALSAVEHAINKLKEMAPIWKKEEYAPGTHTDAQWKENSECM*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LGNVPVSEASVVIAISSPHRQTALSAVEHAINKLKEMAPIWKKEEYAPGTHTDAQWKENSECMWRVVSLHYEAYKSMALKVFKDICNNLRETWPDIVNVAIYHRLGNVPVSEASVVIAISSPHRQTALSAVEHAINKLKEMAPIWKKEEYAPGTHTDAQWKENSECMWRVKH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Molybdopterin synthase catalytic subunit Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group.confidentQ7QAD7
Molybdopterin synthase catalytic subunit Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group.confidentO22827
Molybdopterin synthase catalytic subunit Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group.confidentB5FXU9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006777 [BP]Mo-molybdopterin cofactor biosynthetic processprobableGO:0006732, GO:0044249, GO:0006807, GO:0009108, GO:1901362, GO:1901360, GO:1901576, GO:0051186, GO:0044260, GO:0043545, GO:0051189, GO:0051188, GO:0071704, GO:0018130, GO:0019720, GO:0044267, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0090407, GO:0046483, GO:0044238, GO:1901564, GO:1901566, GO:0019538, GO:0044237, GO:0043170, GO:0006796, GO:0032324, GO:0006793, GO:0019637

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FM0, chain E
Confidence level:very confident
Coverage over the Query: 49-167
View the alignment between query and template
View the model in PyMOL
Template: 2Q5W, chain E
Confidence level:very confident
Coverage over the Query: 1-59
View the alignment between query and template
View the model in PyMOL