Diaphorina citri psyllid: psy11505

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310--

NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDLLSQQWPPNKSIPSLEENKMLEALLLCEPEMLTVRSETPQSDPTLQTINSLSDLYDRELVCIIGWAKQIPGFTDLSLNDQMRLLQSTWAEILTLTIAYRSLPHCAGKIRFASDLVLDERQARECGFSEIYQQVKHSGSLDGIKEEELPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQVYSGYRQTGACGTLVLANSDVKLDEFSSLKKFRNSILSSLGDCIYVLRFWSTVHKDGKVLMNKLFVEMLEAYLR

cccCCcccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccHHHHHccHHHHHHHHHHccccccccccHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcc

NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKE***************************************LEALLLCEP*****************TINSLSDLYDRELVCIIGWAKQIPGFTDLSLNDQMRLLQSTWAEILTLTIAYRSLPHCAGKIRFASDLVLDERQARECGFSEIYQQVKHSGSLDGIKEEELPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQVYSGYRQTGACGTLVLANSDVKLDEFSSLKKFRNSILSSLGDCIYVLRFWSTVHKDGKVLMNKLFVEMLEAY**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Estrogen-related receptor gamma	Orphan receptor that acts as transcription activator in the absence of bound ligand. Binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements.	confident	P62509
Estrogen-related receptor gamma	Orphan receptor that acts as transcription activator in the absence of bound ligand. Binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements.	confident	P62510

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0048384 [BP]	retinoic acid receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0030522, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0043566 [MF]	structure-specific DNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0042562 [MF]	hormone binding	probable	GO:0003674, GO:0005488
GO:0000122 [BP]	negative regulation of transcription from RNA polymerase II promoter	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0042127 [BP]	regulation of cell proliferation	probable	GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0032355 [BP]	response to estradiol stimulus	probable	GO:1901700, GO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0014070, GO:0009725, GO:0043627, GO:0042221, GO:0097305, GO:0010033, GO:0048545
GO:0032526 [BP]	response to retinoic acid	probable	GO:1901700, GO:0033993, GO:0050896, GO:0008150, GO:0042221, GO:0010033
GO:1901701 [BP]	cellular response to oxygen-containing compound	probable	GO:1901700, GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0044699
GO:0043232 [CC]	intracellular non-membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0000980 [MF]	RNA polymerase II distal enhancer sequence-specific DNA binding	probable	GO:0005488, GO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001158, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363, GO:0035326
GO:0010627 [BP]	regulation of intracellular protein kinase cascade	probable	GO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0002761 [BP]	regulation of myeloid leukocyte differentiation	probable	GO:0050793, GO:1902105, GO:0050794, GO:0050789, GO:0045595, GO:0065007, GO:2000026, GO:0008150, GO:0051239, GO:0002682, GO:0045637
GO:0009653 [BP]	anatomical structure morphogenesis	probable	GO:0032502, GO:0048856, GO:0008150
GO:0046982 [MF]	protein heterodimerization activity	probable	GO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0065009 [BP]	regulation of molecular function	probable	GO:0008150, GO:0065007
GO:0003707 [MF]	steroid hormone receptor activity	probable	GO:0003674, GO:0038023, GO:0004872, GO:0004871, GO:0060089
GO:0009967 [BP]	positive regulation of signal transduction	probable	GO:0009966, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0042981 [BP]	regulation of apoptotic process	probable	GO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0016477 [BP]	cell migration	probable	GO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0003682 [MF]	chromatin binding	probable	GO:0003674, GO:0005488
GO:0007420 [BP]	brain development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0006351 [BP]	transcription, DNA-dependent	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0003713 [MF]	transcription coactivator activity	probable	GO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0043005 [CC]	neuron projection	probable	GO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0071383 [BP]	cellular response to steroid hormone stimulus	probable	GO:0071495, GO:0009719, GO:0051716, GO:0071407, GO:0050896, GO:0009987, GO:0071396, GO:0071310, GO:0044699, GO:0009725, GO:0008150, GO:0032870, GO:0044763, GO:0048545, GO:0070887, GO:0033993, GO:0042221, GO:0010033, GO:0014070
GO:0004886 [MF]	9-cis retinoic acid receptor activity	probable	GO:0003708, GO:0038023, GO:0003700, GO:0001071, GO:0060089, GO:0003674, GO:0004879, GO:0004871, GO:0000981, GO:0004872
GO:0030518 [BP]	intracellular steroid hormone receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0030522, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005496 [MF]	steroid binding	probable	GO:0097159, GO:0003674, GO:0008289, GO:0005488
GO:0005667 [CC]	transcription factor complex	probable	GO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0048471 [CC]	perinuclear region of cytoplasm	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0031641 [BP]	regulation of myelination	probable	GO:0051239, GO:0044057, GO:0031644, GO:0032844, GO:0008150, GO:0050793, GO:2000021, GO:2000026, GO:0051960, GO:0023051, GO:0065007, GO:0051969, GO:0010646, GO:0050789, GO:0050794
GO:0045597 [BP]	positive regulation of cell differentiation	probable	GO:0051094, GO:0050793, GO:0050794, GO:0045595, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0043009 [BP]	chordate embryonic development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0007275, GO:0044699
GO:0048699 [BP]	generation of neurons	probable	GO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DZY, chain A
Confidence level:very confident
Coverage over the Query: 1-83,104-204,247-307
View the alignment between query and template
View the model in PyMOL

Template: 2A66, chain A
Confidence level:very confident
Coverage over the Query: 207-245
View the alignment between query and template
View the model in PyMOL