Psyllid ID: psy11505
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 312 | ||||||
| 242021609 | 448 | retinoid X receptor, putative [Pediculus | 0.871 | 0.607 | 0.508 | 4e-86 | |
| 259906648 | 401 | estrogen receptor-like protein [Teleogry | 0.871 | 0.678 | 0.502 | 2e-83 | |
| 345496190 | 438 | PREDICTED: steroid hormone receptor ERR2 | 0.846 | 0.602 | 0.5 | 2e-79 | |
| 340714311 | 430 | PREDICTED: steroid hormone receptor ERR2 | 0.846 | 0.613 | 0.5 | 5e-78 | |
| 340714309 | 434 | PREDICTED: steroid hormone receptor ERR2 | 0.846 | 0.608 | 0.5 | 6e-78 | |
| 383863647 | 434 | PREDICTED: steroid hormone receptor ERR2 | 0.846 | 0.608 | 0.497 | 9e-78 | |
| 242117914 | 434 | estrogen-related receptor [Apis mellifer | 0.846 | 0.608 | 0.5 | 1e-77 | |
| 380025663 | 434 | PREDICTED: steroid hormone receptor ERR2 | 0.846 | 0.608 | 0.5 | 1e-77 | |
| 345496188 | 450 | PREDICTED: steroid hormone receptor ERR2 | 0.846 | 0.586 | 0.482 | 1e-76 | |
| 307201567 | 426 | Steroid hormone receptor ERR2 [Harpegnat | 0.846 | 0.619 | 0.488 | 1e-75 |
| >gi|242021609|ref|XP_002431237.1| retinoid X receptor, putative [Pediculus humanus corporis] gi|212516486|gb|EEB18499.1| retinoid X receptor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 324 bits (830), Expect = 4e-86, Method: Compositional matrix adjust.
Identities = 174/342 (50%), Positives = 217/342 (63%), Gaps = 70/342 (20%)
Query: 1 NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDL-- 58
NIEYTCPA+NDCEINKRRRKACQACRFQKCLR GMLKEGVRLDRVRGGRQKYRRN D
Sbjct: 147 NIEYTCPAANDCEINKRRRKACQACRFQKCLRMGMLKEGVRLDRVRGGRQKYRRNTDTPY 206
Query: 59 -LSQQWPPNKSIPSLEENKMLEALLLCEPEMLTVRSETPQSDPTLQTINSLSDLYDRELV 117
+ P +PSLE+NK+LEAL L EP++ + + +DP ++T+N LSDLYD+ELV
Sbjct: 207 QIHSMLPLKPYLPSLEDNKILEALSLNEPDISVMAQDISNADPAVRTLNILSDLYDQELV 266
Query: 118 CIIGWAKQIPGFTDLSLNDQMRLLQSTWAEILTLTIAYRSLPHCAGKIRFASDLVLDERQ 177
II WAK IPGF DL+LNDQMRLLQSTWAEILTLT+ YRSLP G+++FA+D DE+
Sbjct: 267 KIITWAKHIPGFLDLTLNDQMRLLQSTWAEILTLTVTYRSLPG-TGELKFAADFSFDEKM 325
Query: 178 ARECGFSEIYQQVKHSGSLDGIKEEELPRRLCLVCGDVASGFHYGVASCEACKAFFKRTI 237
ARECG +IYQ H ++E+L ++ +Y + +
Sbjct: 326 ARECGAMDIYQHCMHIVE----RQEKL---------NITKEEYYIIKA------------ 360
Query: 238 QVYSGYRQTGACGTLVLANSDVKLDEFSSLKKFRNSILSSLGDCIYVL------------ 285
LVLANSDV++D+ LKK R++ILS+L DC+ VL
Sbjct: 361 --------------LVLANSDVRIDDLPPLKKLRDNILSALADCVAVLRPNTTSLHMNHL 406
Query: 286 ---------------RFWSTVHKDGKVLMNKLFVEMLEAYLR 312
RFW+ VH++GKV MNKLF+EMLE+Y+R
Sbjct: 407 LLCLPALRQADYINRRFWTAVHREGKVYMNKLFIEMLESYIR 448
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|259906648|gb|ACW84414.1| estrogen receptor-like protein [Teleogryllus emma] | Back alignment and taxonomy information |
|---|
| >gi|345496190|ref|XP_001604033.2| PREDICTED: steroid hormone receptor ERR2 isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|340714311|ref|XP_003395673.1| PREDICTED: steroid hormone receptor ERR2-like isoform 2 [Bombus terrestris] gi|350417321|ref|XP_003491365.1| PREDICTED: steroid hormone receptor ERR2-like isoform 2 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340714309|ref|XP_003395672.1| PREDICTED: steroid hormone receptor ERR2-like isoform 1 [Bombus terrestris] gi|350417319|ref|XP_003491364.1| PREDICTED: steroid hormone receptor ERR2-like isoform 1 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383863647|ref|XP_003707291.1| PREDICTED: steroid hormone receptor ERR2-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|242117914|ref|NP_001155988.1| estrogen-related receptor [Apis mellifera] gi|153793268|gb|ABS50436.1| estrogen-related receptor [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380025663|ref|XP_003696588.1| PREDICTED: steroid hormone receptor ERR2-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|345496188|ref|XP_003427670.1| PREDICTED: steroid hormone receptor ERR2 isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|307201567|gb|EFN81329.1| Steroid hormone receptor ERR2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 312 | ||||||
| UNIPROTKB|F1NBB9 | 438 | ESRRB "Uncharacterized protein | 0.634 | 0.452 | 0.530 | 1.1e-54 | |
| ZFIN|ZDB-GENE-990415-68 | 436 | esrra "estrogen-related recept | 0.589 | 0.422 | 0.557 | 4.8e-54 | |
| ZFIN|ZDB-GENE-030821-2 | 508 | esrrga "estrogen-related recep | 0.644 | 0.395 | 0.511 | 3.3e-53 | |
| UNIPROTKB|F1NBB5 | 393 | ESRRG "Uncharacterized protein | 0.644 | 0.511 | 0.511 | 3.7e-52 | |
| UNIPROTKB|Q5UKY7 | 435 | ESRRG "Nuclear receptor subfam | 0.644 | 0.462 | 0.514 | 3.7e-52 | |
| UNIPROTKB|E1BC39 | 450 | ESRRG "Uncharacterized protein | 0.644 | 0.446 | 0.514 | 3.7e-52 | |
| UNIPROTKB|E2R7U1 | 458 | ESRRG "Uncharacterized protein | 0.644 | 0.438 | 0.514 | 3.7e-52 | |
| UNIPROTKB|J9NWD9 | 435 | ESRRG "Uncharacterized protein | 0.644 | 0.462 | 0.514 | 3.7e-52 | |
| UNIPROTKB|P62508 | 458 | ESRRG "Estrogen-related recept | 0.644 | 0.438 | 0.514 | 3.7e-52 | |
| MGI|MGI:1347056 | 458 | Esrrg "estrogen-related recept | 0.644 | 0.438 | 0.514 | 3.7e-52 |
| UNIPROTKB|F1NBB9 ESRRB "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 520 (188.1 bits), Expect = 1.1e-54, Sum P(2) = 1.1e-54
Identities = 112/211 (53%), Positives = 138/211 (65%)
Query: 1 NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPD--- 57
NIEY+CPA+N+CEI KRRRK+CQACRF KCL+ GMLKEGVRLDRVRGGRQKY+R D
Sbjct: 139 NIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSES 198
Query: 58 --LLSQQWPPNKSIPSLEENKMLEALLLCEPEMLTVRSETPQSDPTLQTINSLSDLYDRE 115
LS Q PP P K++ LL+ EPE + + + ++ + +L DL DRE
Sbjct: 199 STYLSLQIPPPAKKPL---TKIVSHLLVAEPEKIYAMPDPTMPESDIKALTTLCDLADRE 255
Query: 116 LVCIIGWAKQIPGFTDLSLNDQMRLLQSTWAEILTLTIAYRSLPHCAGKIRFASDLVLDE 175
LV IIGWAK IPGF++LSL DQM LLQS W EIL L I YRSLP+ K+ +A D ++DE
Sbjct: 256 LVVIIGWAKHIPGFSNLSLGDQMSLLQSAWMEILILGIVYRSLPY-EDKLVYAEDYIMDE 314
Query: 176 RQARECGFSEIY----QQVKHSGSLDGIKEE 202
+R G E+Y Q V+ L KEE
Sbjct: 315 EHSRLTGLLELYLAILQLVRRYKKLKVEKEE 345
|
|
| ZFIN|ZDB-GENE-990415-68 esrra "estrogen-related receptor alpha" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030821-2 esrrga "estrogen-related receptor gamma a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NBB5 ESRRG "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5UKY7 ESRRG "Nuclear receptor subfamily 3 group B member 3" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BC39 ESRRG "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R7U1 ESRRG "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NWD9 ESRRG "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P62508 ESRRG "Estrogen-related receptor gamma" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1347056 Esrrg "estrogen-related receptor gamma" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 312 | |||
| cd06946 | 221 | cd06946, NR_LBD_ERR, The ligand binding domain of | 7e-70 | |
| cd07068 | 221 | cd07068, NR_LBD_ER_like, The ligand binding domain | 4e-64 | |
| cd07170 | 97 | cd07170, NR_DBD_ERR, DNA-binding domain of estroge | 3e-34 | |
| cd06949 | 235 | cd06949, NR_LBD_ER, Ligand binding domain of Estro | 2e-23 | |
| cd07074 | 248 | cd07074, NR_LBD_PR, Ligand binding domain of the p | 1e-18 | |
| cd07155 | 75 | cd07155, NR_DBD_ER_like, DNA-binding domain of est | 1e-18 | |
| cd07167 | 93 | cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain | 2e-18 | |
| cd07170 | 97 | cd07170, NR_DBD_ERR, DNA-binding domain of estroge | 4e-18 | |
| cd06947 | 246 | cd06947, NR_LBD_GR_Like, Ligand binding domain of | 7e-18 | |
| cd06916 | 72 | cd06916, NR_DBD_like, DNA-binding domain of nuclea | 8e-18 | |
| cd07155 | 75 | cd07155, NR_DBD_ER_like, DNA-binding domain of est | 6e-17 | |
| pfam00104 | 186 | pfam00104, Hormone_recep, Ligand-binding domain of | 2e-16 | |
| cd07076 | 247 | cd07076, NR_LBD_GR, Ligand binding domain of the g | 6e-16 | |
| pfam00105 | 70 | pfam00105, zf-C4, Zinc finger, C4 type (two domain | 2e-15 | |
| cd06916 | 72 | cd06916, NR_DBD_like, DNA-binding domain of nuclea | 5e-15 | |
| pfam00105 | 70 | pfam00105, zf-C4, Zinc finger, C4 type (two domain | 6e-15 | |
| cd07168 | 90 | cd07168, NR_DBD_DHR4_like, DNA-binding domain of e | 7e-15 | |
| cd06930 | 165 | cd06930, NR_LBD_F2, Ligand-binding domain of nucle | 1e-14 | |
| cd06961 | 85 | cd06961, NR_DBD_TR, DNA-binding domain of thyroid | 1e-14 | |
| cd07075 | 248 | cd07075, NR_LBD_MR, Ligand binding domain of the m | 2e-14 | |
| cd07073 | 246 | cd07073, NR_LBD_AR, Ligand binding domain of the n | 4e-14 | |
| cd07171 | 82 | cd07171, NR_DBD_ER, DNA-binding domain of estrogen | 1e-13 | |
| cd07171 | 82 | cd07171, NR_DBD_ER, DNA-binding domain of estrogen | 2e-13 | |
| smart00399 | 70 | smart00399, ZnF_C4, c4 zinc finger in nuclear horm | 3e-13 | |
| cd06945 | 239 | cd06945, NR_LBD_Nurr1_like, The ligand binding dom | 6e-13 | |
| cd07166 | 89 | cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV | 9e-13 | |
| smart00399 | 70 | smart00399, ZnF_C4, c4 zinc finger in nuclear horm | 3e-12 | |
| cd06969 | 75 | cd06969, NR_DBD_NGFI-B, DNA-binding domain of the | 3e-12 | |
| cd07158 | 73 | cd07158, NR_DBD_Ppar_like, The DNA-binding domain | 4e-12 | |
| cd06960 | 76 | cd06960, NR_DBD_HNF4A, DNA-binding domain of hepto | 5e-12 | |
| cd06937 | 231 | cd06937, NR_LBD_RAR, The ligand binding domain (LB | 5e-12 | |
| cd06157 | 168 | cd06157, NR_LBD, The ligand binding domain of nucl | 6e-12 | |
| cd06943 | 207 | cd06943, NR_LBD_RXR_like, The ligand binding domai | 8e-12 | |
| cd06961 | 85 | cd06961, NR_DBD_TR, DNA-binding domain of thyroid | 2e-11 | |
| cd06960 | 76 | cd06960, NR_DBD_HNF4A, DNA-binding domain of hepto | 2e-11 | |
| cd06967 | 87 | cd06967, NR_DBD_TR2_like, DNA-binding domain of th | 3e-11 | |
| cd07169 | 90 | cd07169, NR_DBD_GCNF_like, DNA-binding domain of G | 3e-11 | |
| cd06965 | 84 | cd06965, NR_DBD_Ppar, DNA-binding domain of peroxi | 3e-11 | |
| cd06959 | 73 | cd06959, NR_DBD_EcR_like, The DNA-binding domain o | 4e-11 | |
| cd06964 | 85 | cd06964, NR_DBD_RAR, DNA-binding domain of retinoi | 4e-11 | |
| cd07167 | 93 | cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain | 5e-11 | |
| cd07156 | 72 | cd07156, NR_DBD_VDR_like, The DNA-binding domain o | 6e-11 | |
| cd07168 | 90 | cd07168, NR_DBD_DHR4_like, DNA-binding domain of e | 1e-10 | |
| cd06969 | 75 | cd06969, NR_DBD_NGFI-B, DNA-binding domain of the | 1e-10 | |
| cd07179 | 74 | cd07179, 2DBD_NR_DBD2, The second DNA-binding doma | 1e-10 | |
| cd07165 | 81 | cd07165, NR_DBD_DmE78_like, DNA-binding domain of | 1e-10 | |
| cd06964 | 85 | cd06964, NR_DBD_RAR, DNA-binding domain of retinoi | 3e-10 | |
| cd07160 | 101 | cd07160, NR_DBD_LXR, DNA-binding domain of Liver X | 4e-10 | |
| cd06956 | 77 | cd06956, NR_DBD_RXR, DNA-binding domain of retinoi | 6e-10 | |
| cd07172 | 78 | cd07172, NR_DBD_GR_PR, DNA-binding domain of gluco | 6e-10 | |
| cd07169 | 90 | cd07169, NR_DBD_GCNF_like, DNA-binding domain of G | 7e-10 | |
| cd06956 | 77 | cd06956, NR_DBD_RXR, DNA-binding domain of retinoi | 9e-10 | |
| cd06967 | 87 | cd06967, NR_DBD_TR2_like, DNA-binding domain of th | 1e-09 | |
| cd07157 | 86 | cd07157, 2DBD_NR_DBD1, The first DNA-binding domai | 1e-09 | |
| cd07071 | 238 | cd07071, NR_LBD_Nurr1, The ligand binding domain o | 1e-09 | |
| cd06931 | 222 | cd06931, NR_LBD_HNF4_like, The ligand binding doma | 2e-09 | |
| cd07348 | 238 | cd07348, NR_LBD_NGFI-B, The ligand binding domain | 2e-09 | |
| cd07164 | 78 | cd07164, NR_DBD_PNR_like_1, DNA-binding domain of | 3e-09 | |
| smart00430 | 163 | smart00430, HOLI, Ligand binding domain of hormone | 3e-09 | |
| cd07164 | 78 | cd07164, NR_DBD_PNR_like_1, DNA-binding domain of | 5e-09 | |
| cd07156 | 72 | cd07156, NR_DBD_VDR_like, The DNA-binding domain o | 6e-09 | |
| cd06962 | 84 | cd06962, NR_DBD_FXR, DNA-binding domain of Farneso | 8e-09 | |
| cd06966 | 94 | cd06966, NR_DBD_CAR, DNA-binding domain of constit | 1e-08 | |
| cd06958 | 73 | cd06958, NR_DBD_COUP_TF, DNA-binding domain of chi | 1e-08 | |
| cd07173 | 82 | cd07173, NR_DBD_AR, DNA-binding domain of androgen | 1e-08 | |
| cd07161 | 91 | cd07161, NR_DBD_EcR, DNA-binding domain of Ecdyson | 1e-08 | |
| cd07179 | 74 | cd07179, 2DBD_NR_DBD2, The second DNA-binding doma | 3e-08 | |
| cd07165 | 81 | cd07165, NR_DBD_DmE78_like, DNA-binding domain of | 3e-08 | |
| cd07162 | 87 | cd07162, NR_DBD_PXR, DNA-binding domain of pregnan | 3e-08 | |
| cd06968 | 95 | cd06968, NR_DBD_ROR, DNA-binding domain of Retinoi | 4e-08 | |
| cd07154 | 73 | cd07154, NR_DBD_PNR_like, The DNA-binding domain o | 5e-08 | |
| cd06970 | 92 | cd06970, NR_DBD_PNR, DNA-binding domain of the pho | 5e-08 | |
| cd06968 | 95 | cd06968, NR_DBD_ROR, DNA-binding domain of Retinoi | 7e-08 | |
| cd07172 | 78 | cd07172, NR_DBD_GR_PR, DNA-binding domain of gluco | 1e-07 | |
| cd06958 | 73 | cd06958, NR_DBD_COUP_TF, DNA-binding domain of chi | 1e-07 | |
| cd06963 | 73 | cd06963, NR_DBD_GR_like, The DNA binding domain of | 1e-07 | |
| cd07154 | 73 | cd07154, NR_DBD_PNR_like, The DNA-binding domain o | 2e-07 | |
| cd06955 | 107 | cd06955, NR_DBD_VDR, DNA-binding domain of vitamin | 2e-07 | |
| cd07157 | 86 | cd07157, 2DBD_NR_DBD1, The first DNA-binding domai | 3e-07 | |
| cd07069 | 241 | cd07069, NR_LBD_Lrh-1, The ligand binding domain o | 3e-07 | |
| cd07163 | 92 | cd07163, NR_DBD_TLX, DNA-binding domain of Tailles | 3e-07 | |
| cd06955 | 107 | cd06955, NR_DBD_VDR, DNA-binding domain of vitamin | 4e-07 | |
| cd06963 | 73 | cd06963, NR_DBD_GR_like, The DNA binding domain of | 5e-07 | |
| cd06948 | 236 | cd06948, NR_LBD_COUP-TF, Ligand binding domain of | 5e-07 | |
| cd06965 | 84 | cd06965, NR_DBD_Ppar, DNA-binding domain of peroxi | 7e-07 | |
| cd07158 | 73 | cd07158, NR_DBD_Ppar_like, The DNA-binding domain | 8e-07 | |
| cd06966 | 94 | cd06966, NR_DBD_CAR, DNA-binding domain of constit | 9e-07 | |
| cd06950 | 206 | cd06950, NR_LBD_Tlx_PNR_like, The ligand binding d | 9e-07 | |
| cd06957 | 82 | cd06957, NR_DBD_PNR_like_2, DNA-binding domain of | 1e-06 | |
| cd06944 | 237 | cd06944, NR_LBD_Ftz-F1_like, The ligand binding do | 2e-06 | |
| cd07072 | 239 | cd07072, NR_LBD_DHR38_like, Ligand binding domain | 2e-06 | |
| cd07166 | 89 | cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV | 3e-06 | |
| cd07070 | 237 | cd07070, NR_LBD_SF-1, The ligand binding domain of | 5e-06 | |
| cd07173 | 82 | cd07173, NR_DBD_AR, DNA-binding domain of androgen | 6e-06 | |
| cd07162 | 87 | cd07162, NR_DBD_PXR, DNA-binding domain of pregnan | 6e-06 | |
| cd07163 | 92 | cd07163, NR_DBD_TLX, DNA-binding domain of Tailles | 6e-06 | |
| cd06957 | 82 | cd06957, NR_DBD_PNR_like_2, DNA-binding domain of | 6e-06 | |
| cd06929 | 174 | cd06929, NR_LBD_F1, Ligand-binding domain of nucle | 7e-06 | |
| cd06970 | 92 | cd06970, NR_DBD_PNR, DNA-binding domain of the pho | 1e-05 | |
| cd06953 | 213 | cd06953, NR_LBD_DHR4_like, The ligand binding doma | 4e-05 | |
| cd06933 | 238 | cd06933, NR_LBD_VDR, The ligand binding domain of | 4e-05 | |
| cd07161 | 91 | cd07161, NR_DBD_EcR, DNA-binding domain of Ecdyson | 7e-05 | |
| cd06951 | 222 | cd06951, NR_LBD_Dax1_like, The ligand binding doma | 8e-05 | |
| cd06962 | 84 | cd06962, NR_DBD_FXR, DNA-binding domain of Farneso | 6e-04 | |
| cd06954 | 236 | cd06954, NR_LBD_LXR, The ligand binding domain of | 9e-04 | |
| cd06941 | 195 | cd06941, NR_LBD_DmE78_like, The ligand binding dom | 0.001 | |
| cd06959 | 73 | cd06959, NR_DBD_EcR_like, The DNA-binding domain o | 0.002 | |
| cd07160 | 101 | cd07160, NR_DBD_LXR, DNA-binding domain of Liver X | 0.002 |
| >gnl|CDD|132744 cd06946, NR_LBD_ERR, The ligand binding domain of estrogen receptor-related nuclear receptors | Back alignment and domain information |
|---|
Score = 216 bits (551), Expect = 7e-70
Identities = 94/265 (35%), Positives = 126/265 (47%), Gaps = 76/265 (28%)
Query: 77 MLEALLLCEPEMLTVRSETPQSDPTLQTINSLSDLYDRELVCIIGWAKQIPGFTDLSLND 136
+L LL+ EP+ L + D ++ + +LSDL DRELV IIGWAK IPGF+ LSLND
Sbjct: 1 ILSHLLVAEPDKLFAMPDPALPDSDIKALTTLSDLADRELVVIIGWAKHIPGFSSLSLND 60
Query: 137 QMRLLQSTWAEILTLTIAYRSLPHCAGKIRFASDLVLDERQARECGFSEIY----QQVKH 192
QM LLQS W EILTL + +RSLP G++ FA D +LDE ARE G E+Y Q V+
Sbjct: 61 QMSLLQSAWMEILTLGVVFRSLP-FNGELVFAEDFILDEELAREAGLLELYSACLQLVRR 119
Query: 193 SGSLDGIKEEELPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQVYSGYRQTGACGTL 252
L KEE Y + KA L
Sbjct: 120 LQRLRLEKEE------------------YVL-----LKA--------------------L 136
Query: 253 VLANSDVKL-DEFSSLKKFRNSILSSLGDCIY---------------------------V 284
LANSD ++ ++++ R+++L +L D
Sbjct: 137 ALANSDSVHIEDVEAVRQLRDALLEALSDYEAGRHPGEAPRRAGQLLLTLPLLRQTDGKA 196
Query: 285 LRFWSTVHKDGKVLMNKLFVEMLEA 309
RF+ V ++GKV M+KLF+EMLEA
Sbjct: 197 RRFFYGVKREGKVPMHKLFLEMLEA 221
|
The ligand binding domain of estrogen receptor-related receptors (ERRs): The family of estrogen receptor-related receptors (ERRs), a subfamily of nuclear receptors, is closely related to the estrogen receptor (ER) family, but it lacks the ability to bind estrogen. ERRs can interfere with the classic ER-mediated estrogen signaling pathway, positively or negatively. ERRs share target genes, co-regulators and promoters with the estrogen receptor (ER) family. There are three subtypes of ERRs: alpha, beta and gamma. ERRs bind at least two types of DNA sequence, the estrogen response element and another site, originally characterized as SF-1 (steroidogenic factor 1) response element. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ERR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). Length = 221 |
| >gnl|CDD|132753 cd07068, NR_LBD_ER_like, The ligand binding domain of estrogen receptor and estrogen receptor-related receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143544 cd07170, NR_DBD_ERR, DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132747 cd06949, NR_LBD_ER, Ligand binding domain of Estrogen receptor, which are activated by the hormone 17beta-estradiol (estrogen) | Back alignment and domain information |
|---|
| >gnl|CDD|132759 cd07074, NR_LBD_PR, Ligand binding domain of the progesterone receptor, a member of the nuclear hormone receptor | Back alignment and domain information |
|---|
| >gnl|CDD|143530 cd07155, NR_DBD_ER_like, DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143541 cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143544 cd07170, NR_DBD_ERR, DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132745 cd06947, NR_LBD_GR_Like, Ligand binding domain of nuclear hormone receptors:glucocorticoid receptor, mineralocorticoid receptor , progesterone receptor, and androgen receptor | Back alignment and domain information |
|---|
| >gnl|CDD|143512 cd06916, NR_DBD_like, DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143530 cd07155, NR_DBD_ER_like, DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|215719 pfam00104, Hormone_recep, Ligand-binding domain of nuclear hormone receptor | Back alignment and domain information |
|---|
| >gnl|CDD|132761 cd07076, NR_LBD_GR, Ligand binding domain of the glucocorticoid receptor, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|201004 pfam00105, zf-C4, Zinc finger, C4 type (two domains) | Back alignment and domain information |
|---|
| >gnl|CDD|143512 cd06916, NR_DBD_like, DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|201004 pfam00105, zf-C4, Zinc finger, C4 type (two domains) | Back alignment and domain information |
|---|
| >gnl|CDD|143542 cd07168, NR_DBD_DHR4_like, DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132728 cd06930, NR_LBD_F2, Ligand-binding domain of nuclear receptor family 2 | Back alignment and domain information |
|---|
| >gnl|CDD|143519 cd06961, NR_DBD_TR, DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132760 cd07075, NR_LBD_MR, Ligand binding domain of the mineralocorticoid receptor, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|132758 cd07073, NR_LBD_AR, Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator | Back alignment and domain information |
|---|
| >gnl|CDD|143545 cd07171, NR_DBD_ER, DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143545 cd07171, NR_DBD_ER, DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|197701 smart00399, ZnF_C4, c4 zinc finger in nuclear hormone receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132743 cd06945, NR_LBD_Nurr1_like, The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|143540 cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|197701 smart00399, ZnF_C4, c4 zinc finger in nuclear hormone receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143527 cd06969, NR_DBD_NGFI-B, DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B | Back alignment and domain information |
|---|
| >gnl|CDD|143533 cd07158, NR_DBD_Ppar_like, The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family | Back alignment and domain information |
|---|
| >gnl|CDD|143518 cd06960, NR_DBD_HNF4A, DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132735 cd06937, NR_LBD_RAR, The ligand binding domain (LBD) of retinoic acid receptor (RAR), a members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|132726 cd06157, NR_LBD, The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators | Back alignment and domain information |
|---|
| >gnl|CDD|132741 cd06943, NR_LBD_RXR_like, The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|143519 cd06961, NR_DBD_TR, DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143518 cd06960, NR_DBD_HNF4A, DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143525 cd06967, NR_DBD_TR2_like, DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143543 cd07169, NR_DBD_GCNF_like, DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143523 cd06965, NR_DBD_Ppar, DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143517 cd06959, NR_DBD_EcR_like, The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143522 cd06964, NR_DBD_RAR, DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143541 cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143531 cd07156, NR_DBD_VDR_like, The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143542 cd07168, NR_DBD_DHR4_like, DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143527 cd06969, NR_DBD_NGFI-B, DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B | Back alignment and domain information |
|---|
| >gnl|CDD|143548 cd07179, 2DBD_NR_DBD2, The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143539 cd07165, NR_DBD_DmE78_like, DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143522 cd06964, NR_DBD_RAR, DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143534 cd07160, NR_DBD_LXR, DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143514 cd06956, NR_DBD_RXR, DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143546 cd07172, NR_DBD_GR_PR, DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143543 cd07169, NR_DBD_GCNF_like, DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143514 cd06956, NR_DBD_RXR, DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143525 cd06967, NR_DBD_TR2_like, DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143532 cd07157, 2DBD_NR_DBD1, The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132756 cd07071, NR_LBD_Nurr1, The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132729 cd06931, NR_LBD_HNF4_like, The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes | Back alignment and domain information |
|---|
| >gnl|CDD|132762 cd07348, NR_LBD_NGFI-B, The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143538 cd07164, NR_DBD_PNR_like_1, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|214658 smart00430, HOLI, Ligand binding domain of hormone receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143538 cd07164, NR_DBD_PNR_like_1, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143531 cd07156, NR_DBD_VDR_like, The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143520 cd06962, NR_DBD_FXR, DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143524 cd06966, NR_DBD_CAR, DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143516 cd06958, NR_DBD_COUP_TF, DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143547 cd07173, NR_DBD_AR, DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143535 cd07161, NR_DBD_EcR, DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143548 cd07179, 2DBD_NR_DBD2, The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143539 cd07165, NR_DBD_DmE78_like, DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143536 cd07162, NR_DBD_PXR, DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143526 cd06968, NR_DBD_ROR, DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143529 cd07154, NR_DBD_PNR_like, The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family | Back alignment and domain information |
|---|
| >gnl|CDD|143528 cd06970, NR_DBD_PNR, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143526 cd06968, NR_DBD_ROR, DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143546 cd07172, NR_DBD_GR_PR, DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143516 cd06958, NR_DBD_COUP_TF, DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143521 cd06963, NR_DBD_GR_like, The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143529 cd07154, NR_DBD_PNR_like, The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family | Back alignment and domain information |
|---|
| >gnl|CDD|143513 cd06955, NR_DBD_VDR, DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143532 cd07157, 2DBD_NR_DBD1, The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132754 cd07069, NR_LBD_Lrh-1, The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, | Back alignment and domain information |
|---|
| >gnl|CDD|143537 cd07163, NR_DBD_TLX, DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143513 cd06955, NR_DBD_VDR, DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143521 cd06963, NR_DBD_GR_like, The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132746 cd06948, NR_LBD_COUP-TF, Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family | Back alignment and domain information |
|---|
| >gnl|CDD|143523 cd06965, NR_DBD_Ppar, DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143533 cd07158, NR_DBD_Ppar_like, The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family | Back alignment and domain information |
|---|
| >gnl|CDD|143524 cd06966, NR_DBD_CAR, DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132748 cd06950, NR_LBD_Tlx_PNR_like, The ligand binding domain of Tailless-like proteins, orphan nuclear receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143515 cd06957, NR_DBD_PNR_like_2, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132742 cd06944, NR_LBD_Ftz-F1_like, The ligand binding domain of FTZ-F1 like nuclear receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132757 cd07072, NR_LBD_DHR38_like, Ligand binding domain of DHR38_like proteins, members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|143540 cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132755 cd07070, NR_LBD_SF-1, The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|143547 cd07173, NR_DBD_AR, DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143536 cd07162, NR_DBD_PXR, DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143537 cd07163, NR_DBD_TLX, DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143515 cd06957, NR_DBD_PNR_like_2, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132727 cd06929, NR_LBD_F1, Ligand-binding domain of nuclear receptor family 1 | Back alignment and domain information |
|---|
| >gnl|CDD|143528 cd06970, NR_DBD_PNR, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132751 cd06953, NR_LBD_DHR4_like, The ligand binding domain of orphan nuclear receptor Ecdysone-induced receptor DHR4 | Back alignment and domain information |
|---|
| >gnl|CDD|132731 cd06933, NR_LBD_VDR, The ligand binding domain of vitamin D receptors, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|143535 cd07161, NR_DBD_EcR, DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132749 cd06951, NR_LBD_Dax1_like, The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|143520 cd06962, NR_DBD_FXR, DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|132752 cd06954, NR_LBD_LXR, The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors | Back alignment and domain information |
|---|
| >gnl|CDD|132739 cd06941, NR_LBD_DmE78_like, The ligand binding domain of Drosophila ecdysone-induced protein 78, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|143517 cd06959, NR_DBD_EcR_like, The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143534 cd07160, NR_DBD_LXR, DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 312 | |||
| KOG4215|consensus | 432 | 100.0 | ||
| KOG4217|consensus | 605 | 100.0 | ||
| KOG4218|consensus | 475 | 100.0 | ||
| cd06949 | 235 | NR_LBD_ER Ligand binding domain of Estrogen recept | 99.97 | |
| cd06947 | 246 | NR_LBD_GR_Like Ligand binding domain of nuclear ho | 99.97 | |
| cd06937 | 231 | NR_LBD_RAR The ligand binding domain (LBD) of reti | 99.96 | |
| cd06946 | 221 | NR_LBD_ERR The ligand binding domain of estrogen r | 99.96 | |
| cd06944 | 237 | NR_LBD_Ftz-F1_like The ligand binding domain of FT | 99.96 | |
| cd07076 | 247 | NR_LBD_GR Ligand binding domain of the glucocortic | 99.96 | |
| KOG4216|consensus | 479 | 99.96 | ||
| cd07348 | 238 | NR_LBD_NGFI-B The ligand binding domain of Nurr1, | 99.96 | |
| cd07073 | 246 | NR_LBD_AR Ligand binding domain of the nuclear rec | 99.96 | |
| cd07069 | 241 | NR_LBD_Lrh-1 The ligand binding domain of the live | 99.96 | |
| cd07070 | 237 | NR_LBD_SF-1 The ligand binding domain of nuclear r | 99.96 | |
| cd07068 | 221 | NR_LBD_ER_like The ligand binding domain of estrog | 99.96 | |
| cd07072 | 239 | NR_LBD_DHR38_like Ligand binding domain of DHR38_l | 99.96 | |
| cd07071 | 238 | NR_LBD_Nurr1 The ligand binding domain of Nurr1, a | 99.96 | |
| cd06935 | 243 | NR_LBD_TR The ligand binding domain of thyroid hor | 99.95 | |
| cd06945 | 239 | NR_LBD_Nurr1_like The ligand binding domain of Nur | 99.95 | |
| cd07075 | 248 | NR_LBD_MR Ligand binding domain of the mineralocor | 99.95 | |
| cd06948 | 236 | NR_LBD_COUP-TF Ligand binding domain of chicken ov | 99.95 | |
| cd07074 | 248 | NR_LBD_PR Ligand binding domain of the progesteron | 99.95 | |
| cd07349 | 222 | NR_LBD_SHP The ligand binding domain of DAX1 prote | 99.94 | |
| cd06941 | 195 | NR_LBD_DmE78_like The ligand binding domain of Dro | 99.94 | |
| cd06954 | 236 | NR_LBD_LXR The ligand binding domain of Liver X re | 99.93 | |
| cd07350 | 232 | NR_LBD_Dax1 The ligand binding domain of DAX1 prot | 99.93 | |
| cd06951 | 222 | NR_LBD_Dax1_like The ligand binding domain of DAX1 | 99.93 | |
| cd06931 | 222 | NR_LBD_HNF4_like The ligand binding domain of hept | 99.93 | |
| cd06939 | 241 | NR_LBD_ROR_like The ligand binding domain of Retin | 99.93 | |
| cd06932 | 259 | NR_LBD_PPAR The ligand binding domain of peroxisom | 99.92 | |
| cd06940 | 189 | NR_LBD_REV_ERB The ligand binding domain of REV-ER | 99.92 | |
| cd06933 | 238 | NR_LBD_VDR The ligand binding domain of vitamin D | 99.92 | |
| cd06938 | 231 | NR_LBD_EcR The ligand binding domain (LBD) of the | 99.92 | |
| cd06950 | 206 | NR_LBD_Tlx_PNR_like The ligand binding domain of T | 99.91 | |
| cd06934 | 226 | NR_LBD_PXR_like The ligand binding domain of xenob | 99.91 | |
| cd06943 | 207 | NR_LBD_RXR_like The ligand binding domain of the r | 99.9 | |
| cd06952 | 222 | NR_LBD_TR2_like The ligand binding domain of the o | 99.9 | |
| cd06929 | 174 | NR_LBD_F1 Ligand-binding domain of nuclear recepto | 99.89 | |
| cd06930 | 165 | NR_LBD_F2 Ligand-binding domain of nuclear recepto | 99.89 | |
| cd06936 | 221 | NR_LBD_Fxr The ligand binding domain of Farnesoid | 99.88 | |
| cd06953 | 213 | NR_LBD_DHR4_like The ligand binding domain of orph | 99.88 | |
| cd06942 | 191 | NR_LBD_Sex_1_like The ligand binding domain of Cae | 99.85 | |
| cd06157 | 168 | NR_LBD The ligand binding domain of nuclear recept | 99.76 | |
| smart00430 | 163 | HOLI Ligand binding domain of hormone receptors. | 99.74 | |
| PF00104 | 203 | Hormone_recep: Ligand-binding domain of nuclear ho | 99.73 | |
| cd06961 | 85 | NR_DBD_TR DNA-binding domain of thyroid hormone re | 99.55 | |
| cd07170 | 97 | NR_DBD_ERR DNA-binding domain of estrogen related | 99.54 | |
| KOG4846|consensus | 538 | 99.52 | ||
| cd07169 | 90 | NR_DBD_GCNF_like DNA-binding domain of Germ cell n | 99.51 | |
| cd07167 | 93 | NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 | 99.5 | |
| cd07168 | 90 | NR_DBD_DHR4_like DNA-binding domain of ecdysone-in | 99.5 | |
| cd06967 | 87 | NR_DBD_TR2_like DNA-binding domain of the TR2 and | 99.49 | |
| cd07164 | 78 | NR_DBD_PNR_like_1 DNA-binding domain of the photor | 99.49 | |
| cd06964 | 85 | NR_DBD_RAR DNA-binding domain of retinoic acid rec | 99.48 | |
| cd06956 | 77 | NR_DBD_RXR DNA-binding domain of retinoid X recept | 99.48 | |
| cd07155 | 75 | NR_DBD_ER_like DNA-binding domain of estrogen rece | 99.47 | |
| cd07165 | 81 | NR_DBD_DmE78_like DNA-binding domain of Drosophila | 99.46 | |
| cd06960 | 76 | NR_DBD_HNF4A DNA-binding domain of heptocyte nucle | 99.46 | |
| cd06957 | 82 | NR_DBD_PNR_like_2 DNA-binding domain of the photor | 99.46 | |
| cd07171 | 82 | NR_DBD_ER DNA-binding domain of estrogen receptors | 99.45 | |
| cd07160 | 101 | NR_DBD_LXR DNA-binding domain of Liver X receptors | 99.44 | |
| cd07163 | 92 | NR_DBD_TLX DNA-binding domain of Tailless (TLX) is | 99.44 | |
| cd06962 | 84 | NR_DBD_FXR DNA-binding domain of Farnesoid X recep | 99.43 | |
| cd07166 | 89 | NR_DBD_REV_ERB DNA-binding domain of REV-ERB recep | 99.43 | |
| cd06970 | 92 | NR_DBD_PNR DNA-binding domain of the photoreceptor | 99.43 | |
| cd06968 | 95 | NR_DBD_ROR DNA-binding domain of Retinoid-related | 99.42 | |
| cd07161 | 91 | NR_DBD_EcR DNA-binding domain of Ecdysone receptor | 99.42 | |
| cd06966 | 94 | NR_DBD_CAR DNA-binding domain of constitutive andr | 99.41 | |
| cd06969 | 75 | NR_DBD_NGFI-B DNA-binding domain of the orphan nuc | 99.41 | |
| cd06958 | 73 | NR_DBD_COUP_TF DNA-binding domain of chicken ovalb | 99.39 | |
| cd06916 | 72 | NR_DBD_like DNA-binding domain of nuclear receptor | 99.38 | |
| cd07179 | 74 | 2DBD_NR_DBD2 The second DNA-binding domain (DBD) o | 99.38 | |
| cd07157 | 86 | 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of | 99.38 | |
| cd07156 | 72 | NR_DBD_VDR_like The DNA-binding domain of vitamin | 99.37 | |
| cd07162 | 87 | NR_DBD_PXR DNA-binding domain of pregnane X recept | 99.37 | |
| cd07154 | 73 | NR_DBD_PNR_like The DNA-binding domain of the phot | 99.37 | |
| cd06955 | 107 | NR_DBD_VDR DNA-binding domain of vitamin D recepto | 99.37 | |
| cd06959 | 73 | NR_DBD_EcR_like The DNA-binding domain of Ecdysone | 99.37 | |
| cd06963 | 73 | NR_DBD_GR_like The DNA binding domain of GR_like n | 99.36 | |
| cd07158 | 73 | NR_DBD_Ppar_like The DNA-binding domain of peroxis | 99.35 | |
| cd06965 | 84 | NR_DBD_Ppar DNA-binding domain of peroxisome proli | 99.32 | |
| cd07172 | 78 | NR_DBD_GR_PR DNA-binding domain of glucocorticoid | 99.32 | |
| cd07173 | 82 | NR_DBD_AR DNA-binding domain of androgen receptor | 99.29 | |
| smart00399 | 70 | ZnF_C4 c4 zinc finger in nuclear hormone receptors | 99.22 | |
| PF00105 | 70 | zf-C4: Zinc finger, C4 type (two domains); InterPr | 99.12 | |
| KOG4846|consensus | 538 | 98.9 | ||
| KOG4215|consensus | 432 | 98.65 | ||
| cd07161 | 91 | NR_DBD_EcR DNA-binding domain of Ecdysone receptor | 98.64 | |
| cd06956 | 77 | NR_DBD_RXR DNA-binding domain of retinoid X recept | 98.63 | |
| cd07170 | 97 | NR_DBD_ERR DNA-binding domain of estrogen related | 98.63 | |
| cd06959 | 73 | NR_DBD_EcR_like The DNA-binding domain of Ecdysone | 98.6 | |
| cd07172 | 78 | NR_DBD_GR_PR DNA-binding domain of glucocorticoid | 98.6 | |
| cd07173 | 82 | NR_DBD_AR DNA-binding domain of androgen receptor | 98.59 | |
| cd07171 | 82 | NR_DBD_ER DNA-binding domain of estrogen receptors | 98.58 | |
| cd06963 | 73 | NR_DBD_GR_like The DNA binding domain of GR_like n | 98.56 | |
| cd07155 | 75 | NR_DBD_ER_like DNA-binding domain of estrogen rece | 98.56 | |
| cd07179 | 74 | 2DBD_NR_DBD2 The second DNA-binding domain (DBD) o | 98.55 | |
| cd07168 | 90 | NR_DBD_DHR4_like DNA-binding domain of ecdysone-in | 98.53 | |
| cd07156 | 72 | NR_DBD_VDR_like The DNA-binding domain of vitamin | 98.53 | |
| cd07160 | 101 | NR_DBD_LXR DNA-binding domain of Liver X receptors | 98.53 | |
| cd07162 | 87 | NR_DBD_PXR DNA-binding domain of pregnane X recept | 98.53 | |
| cd07169 | 90 | NR_DBD_GCNF_like DNA-binding domain of Germ cell n | 98.52 | |
| cd06961 | 85 | NR_DBD_TR DNA-binding domain of thyroid hormone re | 98.52 | |
| cd07167 | 93 | NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 | 98.5 | |
| cd06958 | 73 | NR_DBD_COUP_TF DNA-binding domain of chicken ovalb | 98.5 | |
| cd07158 | 73 | NR_DBD_Ppar_like The DNA-binding domain of peroxis | 98.49 | |
| smart00399 | 70 | ZnF_C4 c4 zinc finger in nuclear hormone receptors | 98.48 | |
| cd06962 | 84 | NR_DBD_FXR DNA-binding domain of Farnesoid X recep | 98.46 | |
| cd06955 | 107 | NR_DBD_VDR DNA-binding domain of vitamin D recepto | 98.45 | |
| cd06964 | 85 | NR_DBD_RAR DNA-binding domain of retinoic acid rec | 98.44 | |
| cd06969 | 75 | NR_DBD_NGFI-B DNA-binding domain of the orphan nuc | 98.44 | |
| cd06966 | 94 | NR_DBD_CAR DNA-binding domain of constitutive andr | 98.43 | |
| cd06968 | 95 | NR_DBD_ROR DNA-binding domain of Retinoid-related | 98.43 | |
| cd07164 | 78 | NR_DBD_PNR_like_1 DNA-binding domain of the photor | 98.42 | |
| KOG4217|consensus | 605 | 98.41 | ||
| cd06970 | 92 | NR_DBD_PNR DNA-binding domain of the photoreceptor | 98.41 | |
| cd07163 | 92 | NR_DBD_TLX DNA-binding domain of Tailless (TLX) is | 98.4 | |
| cd07154 | 73 | NR_DBD_PNR_like The DNA-binding domain of the phot | 98.4 | |
| cd06965 | 84 | NR_DBD_Ppar DNA-binding domain of peroxisome proli | 98.39 | |
| cd07165 | 81 | NR_DBD_DmE78_like DNA-binding domain of Drosophila | 98.39 | |
| cd06957 | 82 | NR_DBD_PNR_like_2 DNA-binding domain of the photor | 98.38 | |
| cd06960 | 76 | NR_DBD_HNF4A DNA-binding domain of heptocyte nucle | 98.36 | |
| cd07166 | 89 | NR_DBD_REV_ERB DNA-binding domain of REV-ERB recep | 98.35 | |
| cd06967 | 87 | NR_DBD_TR2_like DNA-binding domain of the TR2 and | 98.33 | |
| cd07157 | 86 | 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of | 98.32 | |
| PF00105 | 70 | zf-C4: Zinc finger, C4 type (two domains); InterPr | 98.31 | |
| KOG4216|consensus | 479 | 98.31 | ||
| cd06916 | 72 | NR_DBD_like DNA-binding domain of nuclear receptor | 98.31 | |
| KOG4218|consensus | 475 | 98.2 |
| >KOG4215|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.8e-46 Score=322.91 Aligned_cols=254 Identities=26% Similarity=0.393 Sum_probs=201.2
Q ss_pred CceeEcCCCCCcccccccccccccCchhHHHHhccccccccccccccccccccCCCCCccCCCCCCCCCCchhHHHHHH-
Q psy11505 1 NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDLLSQQWPPNKSIPSLEENKMLE- 79 (312)
Q Consensus 1 ~~~Y~C~~~~~C~i~~~~R~~Cr~CRf~KCl~vGM~~eaVq~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~- 79 (312)
+..|+|+++++|.|||..||.|||||||||+++||++||||.+|++++.++....... .. ......++.
T Consensus 53 ~~~YtCRF~k~C~VDKdkRNaCRyCRfqKC~~aGMK~eAiQnERDrIg~Rr~~~~~~n--------~~--~~~id~L~~a 122 (432)
T KOG4215|consen 53 NHQYTCRFNKQCVVDKDKRNACRYCRFQKCVRAGMKREAIQNERDRIGSRRPSYEAGN--------EN--SPSIDALVQA 122 (432)
T ss_pred cceeeeeccccccccchhhhhhhHhhHHHHHHhcccHHhhhcccccccccCCCCCCCC--------CC--chhHHHHHhH
Confidence 3579999999999999999999999999999999999999999999987543222111 00 111112211
Q ss_pred -----HHHh----cCcccccccCCCCCCCchhHHHhhHHHHHHHHHHHHHHHHhhCCccccCChHHHHHHHHHHHHHHHH
Q psy11505 80 -----ALLL----CEPEMLTVRSETPQSDPTLQTINSLSDLYDRELVCIIGWAKQIPGFTDLSLNDQMRLLQSTWAEILT 150 (312)
Q Consensus 80 -----~l~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~iewak~lp~F~~L~~~DQi~LLK~~~~~~~~ 150 (312)
.+.. ..+... .......++....+..++++...+++...|||||.+|.|.+|+.+||++|||+...++.+
T Consensus 123 E~~~~q~~~srs~~~~~~~-~d~r~~~~n~~~at~~Dv~eSm~qqLlllVEWAK~i~~F~el~l~DqvaLLk~~a~~hll 201 (432)
T KOG4215|consen 123 EALVRQLRSSRSGGVPGID-GDIRQGPPNKKIATENDVCESMKQQLLLLVEWAKYIPPFCELPLDDQVALLKAHAGQHLL 201 (432)
T ss_pred HHHHhhhhccccccCcCcc-hhhhcCccccccccHHHHHHHHHHHHHHHHHHHHhccchhcCCchhHHHHHHccchhhhh
Confidence 1111 001000 000011234456778899999999999999999999999999999999999999999999
Q ss_pred HhhhhhcccCCCCeeEecccchhhHHhhhhcc----cchhhhhhcccCccCCCCccccCCceeeeeCCCCcccccccccc
Q psy11505 151 LTIAYRSLPHCAGKIRFASDLVLDERQARECG----FSEIYQQVKHSGSLDGIKEEELPRRLCLVCGDVASGFHYGVASC 226 (312)
Q Consensus 151 L~~a~rs~~~~~~~l~~~~g~~~~~~~~~~~~----~~~~~~~i~~~~~~L~ld~~E~~~~~c~~~~~~~~~~~~~~~~~ 226 (312)
|..++||.-.++ .++++|+.+++++...... ..+++++++.++++|++|+.||
T Consensus 202 Lg~a~RSm~l~~-v~ll~N~~v~~~~~~~~~eis~v~~RIiDElv~Pmr~L~md~~Ey---------------------- 258 (432)
T KOG4215|consen 202 LGAAFRSMHLKD-VCLLNNTYVLHRHAPDLPEISRVAPRIIDELVNPMRRLQMDEIEY---------------------- 258 (432)
T ss_pred hhhhhccccccc-eEEecCceeeccCCCChHHHHHHHHHHHHHHhhHHHHhccchHHH----------------------
Confidence 999999999976 6778888887765443322 3678899999999999999999
Q ss_pred hhHHHHHHHHhhhcccceecCCCCceeecCCCCc-ccchH--HHHHHHHHHHHHhHhHHHHH-------hh---------
Q psy11505 227 EACKAFFKRTIQVYSGYRQTGACGTLVLANSDVK-LDEFS--SLKKFRNSILSSLGDCIYVL-------RF--------- 287 (312)
Q Consensus 227 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~-l~~~~--~~~~~~~~~~~~l~~~~~~~-------~~--------- 287 (312)
++||||++|+||++ |++++ .|+++|++++.+|.+||.-+ ||
T Consensus 259 --------------------~cLKAi~FfdP~akGis~~s~~~I~~aR~~vl~sLe~yi~d~q~~d~~~R~g~LLLllPs 318 (432)
T KOG4215|consen 259 --------------------VCLKAIAFFDPDAKGLSDPSQIRIREARNRVLKSLEAYISDRQPYDAPGRFGNLLLLLPS 318 (432)
T ss_pred --------------------HHHHHHHhcCccccccCCchHhHHHHHHHHHHHHHHHHHhhcCccccccchhhHHHHHHH
Confidence 99999999999998 99999 79999999999999999765 33
Q ss_pred -----------hhccccCCccchhHHHHHHHh
Q psy11505 288 -----------WSTVHKDGKVLMNKLFVEMLE 308 (312)
Q Consensus 288 -----------~~~~~~~~~~~~~~~~~~~~~ 308 (312)
..+.+++|.+.+++|+.||+.
T Consensus 319 LqsIt~qliE~iqlaklFGla~vDsll~e~~l 350 (432)
T KOG4215|consen 319 LQSITQQLIEQIQLAKLFGLAKVDSLLQEFLL 350 (432)
T ss_pred HHHHHHHHHHHHHHHHHhhhhhHhHHHHHhhc
Confidence 445699999999999999984
|
|
| >KOG4217|consensus | Back alignment and domain information |
|---|
| >KOG4218|consensus | Back alignment and domain information |
|---|
| >cd06949 NR_LBD_ER Ligand binding domain of Estrogen receptor, which are activated by the hormone 17beta-estradiol (estrogen) | Back alignment and domain information |
|---|
| >cd06947 NR_LBD_GR_Like Ligand binding domain of nuclear hormone receptors:glucocorticoid receptor, mineralocorticoid receptor , progesterone receptor, and androgen receptor | Back alignment and domain information |
|---|
| >cd06937 NR_LBD_RAR The ligand binding domain (LBD) of retinoic acid receptor (RAR), a members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06946 NR_LBD_ERR The ligand binding domain of estrogen receptor-related nuclear receptors | Back alignment and domain information |
|---|
| >cd06944 NR_LBD_Ftz-F1_like The ligand binding domain of FTZ-F1 like nuclear receptors | Back alignment and domain information |
|---|
| >cd07076 NR_LBD_GR Ligand binding domain of the glucocorticoid receptor, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >KOG4216|consensus | Back alignment and domain information |
|---|
| >cd07348 NR_LBD_NGFI-B The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors | Back alignment and domain information |
|---|
| >cd07073 NR_LBD_AR Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator | Back alignment and domain information |
|---|
| >cd07069 NR_LBD_Lrh-1 The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, | Back alignment and domain information |
|---|
| >cd07070 NR_LBD_SF-1 The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07068 NR_LBD_ER_like The ligand binding domain of estrogen receptor and estrogen receptor-related receptors | Back alignment and domain information |
|---|
| >cd07072 NR_LBD_DHR38_like Ligand binding domain of DHR38_like proteins, members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07071 NR_LBD_Nurr1 The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors | Back alignment and domain information |
|---|
| >cd06935 NR_LBD_TR The ligand binding domain of thyroid hormone receptor, a members of a superfamily of nuclear receptors | Back alignment and domain information |
|---|
| >cd06945 NR_LBD_Nurr1_like The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07075 NR_LBD_MR Ligand binding domain of the mineralocorticoid receptor, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06948 NR_LBD_COUP-TF Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family | Back alignment and domain information |
|---|
| >cd07074 NR_LBD_PR Ligand binding domain of the progesterone receptor, a member of the nuclear hormone receptor | Back alignment and domain information |
|---|
| >cd07349 NR_LBD_SHP The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >cd06941 NR_LBD_DmE78_like The ligand binding domain of Drosophila ecdysone-induced protein 78, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06954 NR_LBD_LXR The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors | Back alignment and domain information |
|---|
| >cd07350 NR_LBD_Dax1 The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >cd06951 NR_LBD_Dax1_like The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >cd06931 NR_LBD_HNF4_like The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes | Back alignment and domain information |
|---|
| >cd06939 NR_LBD_ROR_like The ligand binding domain of Retinoid-related orphan receptors, of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06932 NR_LBD_PPAR The ligand binding domain of peroxisome proliferator-activated receptors | Back alignment and domain information |
|---|
| >cd06940 NR_LBD_REV_ERB The ligand binding domain of REV-ERB receptors, members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06933 NR_LBD_VDR The ligand binding domain of vitamin D receptors, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06938 NR_LBD_EcR The ligand binding domain (LBD) of the Ecdysone receptor, a member of the nuclear receptors super family | Back alignment and domain information |
|---|
| >cd06950 NR_LBD_Tlx_PNR_like The ligand binding domain of Tailless-like proteins, orphan nuclear receptors | Back alignment and domain information |
|---|
| >cd06934 NR_LBD_PXR_like The ligand binding domain of xenobiotic receptors:pregnane X receptor and constitutive androstane receptor | Back alignment and domain information |
|---|
| >cd06943 NR_LBD_RXR_like The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06952 NR_LBD_TR2_like The ligand binding domain of the orphan nuclear receptors TR4 and TR2 | Back alignment and domain information |
|---|
| >cd06929 NR_LBD_F1 Ligand-binding domain of nuclear receptor family 1 | Back alignment and domain information |
|---|
| >cd06930 NR_LBD_F2 Ligand-binding domain of nuclear receptor family 2 | Back alignment and domain information |
|---|
| >cd06936 NR_LBD_Fxr The ligand binding domain of Farnesoid X receptor:a member of the nuclear receptor superfamily of ligand-activated transcription factors | Back alignment and domain information |
|---|
| >cd06953 NR_LBD_DHR4_like The ligand binding domain of orphan nuclear receptor Ecdysone-induced receptor DHR4 | Back alignment and domain information |
|---|
| >cd06942 NR_LBD_Sex_1_like The ligand binding domain of Caenorhabditis elegans nuclear hormone receptor Sex-1 protein | Back alignment and domain information |
|---|
| >cd06157 NR_LBD The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators | Back alignment and domain information |
|---|
| >smart00430 HOLI Ligand binding domain of hormone receptors | Back alignment and domain information |
|---|
| >PF00104 Hormone_recep: Ligand-binding domain of nuclear hormone receptor; InterPro: IPR000536 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis | Back alignment and domain information |
|---|
| >cd06961 NR_DBD_TR DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >KOG4846|consensus | Back alignment and domain information |
|---|
| >cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07167 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07164 NR_DBD_PNR_like_1 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06964 NR_DBD_RAR DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06957 NR_DBD_PNR_like_2 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06962 NR_DBD_FXR DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06970 NR_DBD_PNR DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06969 NR_DBD_NGFI-B DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B | Back alignment and domain information |
|---|
| >cd06958 NR_DBD_COUP_TF DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06916 NR_DBD_like DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07179 2DBD_NR_DBD2 The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07154 NR_DBD_PNR_like The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family | Back alignment and domain information |
|---|
| >cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family | Back alignment and domain information |
|---|
| >cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors | Back alignment and domain information |
|---|
| >PF00105 zf-C4: Zinc finger, C4 type (two domains); InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis | Back alignment and domain information |
|---|
| >KOG4846|consensus | Back alignment and domain information |
|---|
| >KOG4215|consensus | Back alignment and domain information |
|---|
| >cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07179 2DBD_NR_DBD2 The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06961 NR_DBD_TR DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07167 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06958 NR_DBD_COUP_TF DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family | Back alignment and domain information |
|---|
| >smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors | Back alignment and domain information |
|---|
| >cd06962 NR_DBD_FXR DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06964 NR_DBD_RAR DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06969 NR_DBD_NGFI-B DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B | Back alignment and domain information |
|---|
| >cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07164 NR_DBD_PNR_like_1 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >KOG4217|consensus | Back alignment and domain information |
|---|
| >cd06970 NR_DBD_PNR DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07154 NR_DBD_PNR_like The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family | Back alignment and domain information |
|---|
| >cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06957 NR_DBD_PNR_like_2 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >PF00105 zf-C4: Zinc finger, C4 type (two domains); InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis | Back alignment and domain information |
|---|
| >KOG4216|consensus | Back alignment and domain information |
|---|
| >cd06916 NR_DBD_like DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >KOG4218|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 312 | ||||
| 2ewp_A | 226 | Crystal Structure Of Estrogen Related Receptor-3 (E | 5e-26 | ||
| 1kv6_A | 230 | X-Ray Structure Of The Orphan Nuclear Receptor Err3 | 5e-26 | ||
| 1vjb_A | 251 | Crystal Structure Of The Ligand-Binding Domain Of T | 5e-26 | ||
| 1s9q_A | 251 | Crystal Structure Of The Ligand-Binding Domain Of T | 5e-26 | ||
| 1s9p_A | 227 | Crystal Structure Of The Ligand-Binding Domain Of T | 5e-26 | ||
| 2e2r_A | 244 | Crystal Structure Of Human Estrogen-Related Recepto | 5e-26 | ||
| 2pjl_A | 247 | Crystal Structure Of Human Estrogen-Related Recepto | 3e-25 | ||
| 3d24_A | 253 | Crystal Structure Of Ligand-Binding Domain Of Estro | 1e-24 | ||
| 3k6p_A | 248 | Estrogen Related Receptor Alpha In Complex With An | 3e-24 | ||
| 1xb7_A | 247 | X-Ray Structure Of Erralpha Lbd In Complex With A P | 3e-24 | ||
| 3dzu_A | 467 | Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp | 1e-22 | ||
| 3dzu_A | 467 | Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp | 8e-08 | ||
| 1lo1_A | 98 | Estrogen Related Receptor 2 Dna Binding Domain In C | 5e-21 | ||
| 1lo1_A | 98 | Estrogen Related Receptor 2 Dna Binding Domain In C | 5e-14 | ||
| 1qkt_A | 248 | Mutant Estrogen Nuclear Receptor Ligand Binding Dom | 7e-20 | ||
| 2yat_A | 252 | Crystal Structure Of Estradiol Derived Metal Chelat | 7e-20 | ||
| 1uom_A | 254 | The Structure Of Estrogen Receptor In Complex With | 7e-20 | ||
| 1pcg_A | 244 | Helix-Stabilized Cyclic Peptides As Selective Inhib | 7e-20 | ||
| 3q95_B | 260 | Crystal Structure Of Human Estrogen Receptor Alpha | 2e-19 | ||
| 1zky_A | 257 | Human Estrogen Receptor Alpha Ligand-Binding Domain | 3e-19 | ||
| 2ocf_A | 298 | Human Estrogen Receptor Alpha Ligand-Binding Domain | 3e-19 | ||
| 3uu7_B | 251 | Crystal Structure Of Hera-Lbd (Y537s) In Complex Wi | 3e-19 | ||
| 3hm1_A | 253 | Crystal Structure Of Human Estrogen Receptor Alpha | 3e-19 | ||
| 3q97_A | 260 | Crystal Structure Of Human Estrogen Receptor Alpha | 3e-19 | ||
| 3uu7_A | 251 | Crystal Structure Of Hera-Lbd (Y537s) In Complex Wi | 3e-19 | ||
| 2jfa_B | 252 | Estrogen Receptor Alpha Lbd In Complex With An Affi | 4e-19 | ||
| 1l2i_A | 261 | Human Estrogen Receptor Alpha Ligand-Binding Domain | 5e-19 | ||
| 2qa8_B | 258 | Crystal Structure Of The Estrogen Receptor Alpha Li | 8e-19 | ||
| 2fsz_A | 246 | A Second Binding Site For Hydroxytamoxifen Within T | 8e-19 | ||
| 1err_A | 253 | Human Estrogen Receptor Ligand-Binding Domain In Co | 8e-19 | ||
| 3uuc_A | 251 | Crystal Structure Of Hera-Lbd (Wt) In Complex With | 8e-19 | ||
| 2qzo_B | 258 | Crystal Structure Of The Estrogen Receptor Alpha Li | 8e-19 | ||
| 3q95_A | 260 | Crystal Structure Of Human Estrogen Receptor Alpha | 8e-19 | ||
| 3uua_A | 251 | Crystal Structure Of Hera-Lbd (Y537s) In Complex Wi | 9e-19 | ||
| 3uua_B | 251 | Crystal Structure Of Hera-Lbd (Y537s) In Complex Wi | 1e-18 | ||
| 2bj4_A | 252 | Estrogen Receptor Alpha Lbd In Complex With A Phage | 1e-18 | ||
| 1a52_A | 258 | Estrogen Receptor Alpha Ligand-Binding Domain Compl | 1e-18 | ||
| 3dt3_A | 255 | Human Estrogen Receptor Alpha Lbd With Gw368 Length | 1e-18 | ||
| 3l03_A | 253 | Crystal Structure Of Human Estrogen Receptor Alpha | 1e-18 | ||
| 1ere_A | 253 | Human Estrogen Receptor Ligand-Binding Domain In Co | 1e-18 | ||
| 2iok_A | 254 | Human Estrogen Receptor Alpha Ligand-binding Domain | 1e-18 | ||
| 3erd_A | 261 | Human Estrogen Receptor Alpha Ligand-Binding Domain | 1e-18 | ||
| 2qa8_A | 258 | Crystal Structure Of The Estrogen Receptor Alpha Li | 1e-18 | ||
| 1gwq_A | 248 | Human Oestrogen Receptor Alpha Ligand-Binding Domai | 1e-18 | ||
| 4dma_A | 247 | Crystal Structure Of Era Lbd In Complex With Ru1001 | 1e-18 | ||
| 3hlv_A | 253 | Crystal Structure Of Human Estrogen Receptor Alpha | 1e-18 | ||
| 1qku_A | 250 | Wild Type Estrogen Nuclear Receptor Ligand Binding | 1e-18 | ||
| 2p15_A | 258 | Crystal Structure Of The Er Alpha Ligand Binding Do | 1e-18 | ||
| 2qxs_A | 258 | Crystal Structure Of Antagonizing Mutant 536s Of Th | 2e-18 | ||
| 1gwr_A | 245 | Human Oestrogen Receptor Alpha Ligand-Binding Domai | 2e-18 | ||
| 2iog_A | 246 | Human Estrogen Receptor Alpha Ligand-Binding Domain | 2e-18 | ||
| 1g50_A | 247 | Crystal Structure Of A Wild Type Her Alpha Lbd At 2 | 2e-18 | ||
| 1sj0_A | 248 | Human Estrogen Receptor Alpha Ligand-binding Domain | 2e-18 | ||
| 1qkn_A | 255 | Rat Oestrogen Receptor Beta Ligand-Binding Domain I | 2e-18 | ||
| 2j7x_A | 255 | Structure Of Estradiol-bound Estrogen Receptor Beta | 2e-18 | ||
| 3ltx_A | 243 | Crystal Structure Of The Pacific Oyster Estrogen Re | 3e-18 | ||
| 3os8_A | 258 | Estrogen Receptor Length = 258 | 3e-18 | ||
| 1nde_A | 255 | Estrogen Receptor Beta With Selective Triazine Modu | 7e-18 | ||
| 2i0g_A | 257 | Benzopyrans Are Selective Estrogen Receptor Beta Ag | 7e-18 | ||
| 1qkm_A | 255 | Human Oestrogen Receptor Beta Ligand-Binding Domain | 7e-18 | ||
| 2nv7_A | 238 | Crystal Structure Of Estrogen Receptor Beta Complex | 7e-18 | ||
| 1zaf_A | 238 | Crystal Structure Of Estrogen Receptor Beta Complex | 7e-18 | ||
| 3oll_A | 240 | Crystal Structure Of Phosphorylated Estrogen Recept | 8e-18 | ||
| 2giu_A | 241 | Human Estrogen Receptor Beta Ligand-Binding Domain | 8e-18 | ||
| 1l2j_A | 271 | Human Estrogen Receptor Beta Ligand-Binding Domain | 8e-18 | ||
| 1x76_A | 240 | Crystal Structure Of Estrogen Receptor Beta Complex | 8e-18 | ||
| 1u9e_A | 241 | Crystal Structure Of Estrogen Receptor Beta Complex | 8e-18 | ||
| 2yly_A | 240 | Sulfonamides As Selective Estrogen Receptor Beta Ag | 8e-18 | ||
| 3os8_C | 258 | Estrogen Receptor Length = 258 | 1e-17 | ||
| 1yy4_A | 268 | Crystal Structure Of Estrogen Receptor Beta Complex | 1e-17 | ||
| 1x7e_A | 245 | Crystal Structure Of Estrogen Receptor Alpha Comple | 1e-17 | ||
| 3kba_A | 253 | Progesterone Receptor Bound To Sulfonamide Pyrrolid | 1e-15 | ||
| 1a28_A | 256 | Hormone-Bound Human Progesterone Receptor Ligand-Bi | 1e-15 | ||
| 1e3k_A | 258 | Human Progesteron Receptor Ligand Binding Domain In | 1e-15 | ||
| 3g8o_A | 263 | Progesterone Receptor With Bound Pyrrolidine 1 Leng | 1e-15 | ||
| 2w8y_A | 260 | Ru486 Bound To The Progesterone Receptor In A Desta | 1e-15 | ||
| 1sr7_A | 259 | Progesterone Receptor Hormone Binding Domain With B | 1e-15 | ||
| 1sqn_A | 261 | Progesterone Receptor Ligand Binding Domain With Bo | 1e-15 | ||
| 4fne_A | 254 | X-Ray Crystal Structure Of The Ancestral 3-Keto Ste | 2e-15 | ||
| 2q1h_A | 250 | Ancestral Corticoid Receptor In Complex With Aldost | 3e-15 | ||
| 2q3y_A | 249 | Ancestral Corticiod Receptor In Complex With Doc Le | 3e-15 | ||
| 3ry9_A | 250 | Crystal Structure Of The Resurrected Ancestral Gluc | 2e-14 | ||
| 3h52_A | 254 | Crystal Structure Of The Antagonist Form Of Human G | 1e-13 | ||
| 3cld_A | 259 | Ligand Binding Domain Of The Glucocorticoid Recepto | 2e-13 | ||
| 1nhz_A | 280 | Crystal Structure Of The Antagonist Form Of Glucoco | 2e-13 | ||
| 3bqd_A | 255 | Doubling The Size Of The Glucocorticoid Receptor Li | 2e-13 | ||
| 3e7c_A | 257 | Glucocorticoid Receptor Lbd Bound To Gsk866 Length | 2e-13 | ||
| 3mne_A | 261 | Crystal Structure Of The Agonist Form Of Mouse Gluc | 2e-13 | ||
| 3mno_A | 261 | Crystal Structure Of The Agonist Form Of Mouse Gluc | 2e-13 | ||
| 3mnp_A | 261 | Crystal Structure Of The Agonist Form Of Mouse Gluc | 3e-13 | ||
| 1m2z_A | 257 | Crystal Structure Of A Dimer Complex Of The Human G | 4e-13 | ||
| 3vhv_A | 260 | Mineralocorticoid Receptor Ligand-Binding Domain Wi | 5e-13 | ||
| 3vhu_A | 294 | Mineralocorticoid Receptor Ligand-Binding Domain Wi | 6e-13 | ||
| 2aa6_A | 275 | Mineralocorticoid Receptor S810l Mutant With Bound | 6e-13 | ||
| 4e2j_A | 250 | X-Ray Crystal Structure Of The Ancestral Glucocorti | 1e-12 | ||
| 3gn8_A | 249 | X-Ray Crystal Structure Of Ancgr2 In Complex With D | 1e-12 | ||
| 2oax_A | 256 | Crystal Structure Of The S810l Mutant Mineralocorti | 2e-12 | ||
| 1y9r_A | 255 | Crystal Structure Of The Human Mineralocorticoid Re | 2e-12 | ||
| 2a3i_A | 253 | Structural And Biochemical Mechanisms For The Speci | 3e-12 | ||
| 2q60_A | 258 | Crystal Structure Of The Ligand Binding Domain Of P | 3e-12 | ||
| 1i38_A | 260 | Crystal Structure Of The Rat Androgen Receptor Liga | 4e-12 | ||
| 2ax6_A | 256 | Crystal Structure Of The Androgen Receptor Ligand B | 4e-12 | ||
| 2ax9_A | 256 | Crystal Structure Of The Androgen Receptor Ligand B | 4e-12 | ||
| 1i37_A | 260 | Crystal Structure Of The Rat Androgen Receptor Liga | 4e-12 | ||
| 3rll_A | 247 | Crystal Structure Of The T877a Androgen Receptor Li | 4e-12 | ||
| 2q7k_A | 257 | The Androgen Receptor Prostate Cancer Mutant H874y | 4e-12 | ||
| 2aa2_A | 275 | Mineralocorticoid Receptor With Bound Aldosterone L | 4e-12 | ||
| 1e3g_A | 263 | Human Androgen Receptor Ligand Binding In Complex W | 4e-12 | ||
| 1xj7_A | 257 | Complex Androgen Receptor Lbd And Rac3 Peptide Leng | 4e-12 | ||
| 1t73_A | 269 | Crystal Structure Of The Androgen Receptor Ligand B | 4e-12 | ||
| 3rlj_A | 247 | Crystal Structure Of The Androgen Receptor Ligand B | 4e-12 | ||
| 1t5z_A | 251 | Crystal Structure Of The Androgen Receptor Ligand B | 4e-12 | ||
| 2hvc_A | 250 | The Crystal Structure Of Ligand-Binding Domain (Lbd | 4e-12 | ||
| 3l3x_A | 250 | Crystal Structure Of Dht-Bound Androgen Receptor In | 4e-12 | ||
| 2z4j_A | 248 | Crystal Structure Of Ar Lbd With Shp Peptide Nr Box | 4e-12 | ||
| 2oz7_A | 249 | Crystal Structure Of The Human Androgen Receptor T8 | 4e-12 | ||
| 1xow_A | 249 | Crystal Structure Of The Human Androgen Receptor Li | 5e-12 | ||
| 2am9_A | 266 | Crystal Structure Of Human Androgen Receptor Ligand | 5e-12 | ||
| 1gs4_A | 248 | Structural Basis For The Glucocorticoid Response In | 1e-11 | ||
| 2abi_A | 256 | Crystal Structure Of The Human Mineralocorticoid Re | 1e-11 | ||
| 1z5x_U | 262 | Hemipteran Ecdysone Receptor Ligand-Binding Domain | 4e-11 | ||
| 1z95_A | 246 | Crystal Structure Of The Androgen Receptor Ligand-B | 1e-10 | ||
| 1hcq_A | 84 | The Crystal Structure Of The Estrogen Receptor Dna- | 1e-10 | ||
| 1hcq_A | 84 | The Crystal Structure Of The Estrogen Receptor Dna- | 1e-08 | ||
| 2ax8_A | 256 | Crystal Structure Of The Androgen Receptor Ligand B | 2e-10 | ||
| 1lbd_A | 282 | Ligand-Binding Domain Of The Human Nuclear Receptor | 2e-10 | ||
| 2ff0_A | 102 | Solution Structure Of Steroidogenic Factor 1 Dna Bi | 4e-10 | ||
| 2ff0_A | 102 | Solution Structure Of Steroidogenic Factor 1 Dna Bi | 7e-08 | ||
| 2gl8_A | 241 | Human Retinoic Acid Receptor Rxr-Gamma Ligand-Bindi | 4e-10 | ||
| 2a66_A | 113 | Human Liver Receptor Homologue Dna-Binding Domain ( | 8e-10 | ||
| 2a66_A | 113 | Human Liver Receptor Homologue Dna-Binding Domain ( | 8e-08 | ||
| 3a9e_A | 240 | Crystal Structure Of A Mixed Agonist-Bound Rar-Alph | 1e-09 | ||
| 1xdk_A | 238 | Crystal Structure Of The RarbetaRXRALPHA LIGAND BIN | 1e-09 | ||
| 1dkf_A | 233 | Crystal Structure Of A Heterodimeric Complex Of Rar | 2e-09 | ||
| 1xiu_A | 230 | Crystal Structure Of The Agonist-Bound Ligand-Bindi | 2e-09 | ||
| 1rdt_A | 242 | Crystal Structure Of A New Rexinoid Bound To The Rx | 2e-09 | ||
| 3e94_A | 244 | Crystal Structure Of Rxralpha Ligand Binding Domain | 3e-09 | ||
| 3uvv_B | 244 | Crystal Structure Of The Ligand Binding Domains Of | 3e-09 | ||
| 3eyb_A | 219 | Structural And Functional Insights Into The Ligand | 3e-09 | ||
| 1hlz_A | 94 | Crystal Structure Of The Orphan Nuclear Receptor Re | 3e-09 | ||
| 1fby_A | 239 | Crystal Structure Of The Human Rxr Alpha Ligand Bin | 3e-09 | ||
| 1xv9_A | 236 | Crystal Structure Of CarRXR HETERODIMER BOUND WITH | 3e-09 | ||
| 1fm6_A | 238 | The 2.1 Angstrom Resolution Crystal Structure Of Th | 3e-09 | ||
| 3pcu_A | 230 | Crystal Structure Of Human Retinoic X Receptor Alph | 3e-09 | ||
| 1mv9_A | 240 | Crystal Structure Of The Human Rxr Alpha Ligand Bin | 3e-09 | ||
| 3h0a_A | 228 | Crystal Structure Of Peroxisome Proliferator-Activa | 3e-09 | ||
| 1xls_A | 232 | Crystal Structure Of The Mouse CarRXR LBD HETERODIM | 3e-09 | ||
| 3oap_A | 231 | Crystal Structure Of Human Retinoid X Receptor Alph | 3e-09 | ||
| 1hcp_A | 76 | Dna Recognition By The Oestrogen Receptor: From Sol | 1e-08 | ||
| 4aa6_E | 71 | The Oestrogen Receptor Recognizes An Imperfectly Pa | 1e-08 | ||
| 4aa6_A | 71 | The Oestrogen Receptor Recognizes An Imperfectly Pa | 1e-08 | ||
| 3dzu_D | 419 | Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp | 1e-08 | ||
| 1fcy_A | 236 | Isotype Selectivity Of The Human Retinoic Acid Nucl | 2e-08 | ||
| 1cit_A | 89 | Dna-Binding Mechanism Of The Monomeric Orphan Nucle | 2e-08 | ||
| 1cit_A | 89 | Dna-Binding Mechanism Of The Monomeric Orphan Nucle | 5e-08 | ||
| 1ovl_A | 271 | Crystal Structure Of Nurr1 Lbd Length = 271 | 2e-08 | ||
| 1fcx_A | 235 | Isotype Selectivity Of The Human Retinoic Acid Nucl | 2e-08 | ||
| 1exa_A | 246 | Enantiomer Discrimination Illustrated By Crystal St | 2e-08 | ||
| 2lbd_A | 267 | Ligand-Binding Domain Of The Human Retinoic Acid Re | 2e-08 | ||
| 2nxx_A | 235 | Crystal Structure Of The Ligand-Binding Domains Of | 3e-08 | ||
| 1ovl_B | 271 | Crystal Structure Of Nurr1 Lbd Length = 271 | 4e-08 | ||
| 1lat_A | 82 | Glucocorticoid Receptor MutantDNA COMPLEX Length = | 6e-08 | ||
| 2env_A | 88 | Solution Sturcture Of The C4-Type Zinc Finger Domai | 6e-08 | ||
| 2qw4_A | 273 | Human Nr4a1 Ligand-Binding Domain Length = 273 | 8e-08 | ||
| 1h9u_A | 224 | The Structure Of The Human Retinoid-X-Receptor Beta | 8e-08 | ||
| 1uhl_A | 236 | Crystal Structure Of The Lxralfa-Rxrbeta Lbd Hetero | 9e-08 | ||
| 3v3e_B | 257 | Crystal Structure Of The Human Nur77 Ligand-Binding | 9e-08 | ||
| 1yje_A | 264 | Crystal Structure Of The Rngfi-B Ligand-Binding Dom | 1e-07 | ||
| 2han_A | 93 | Structural Basis Of Heterodimeric Ecdysteroid Recep | 1e-07 | ||
| 1ynw_B | 99 | Crystal Structure Of Vitamin D Receptor And 9-Cis R | 1e-07 | ||
| 1r0o_A | 86 | Crystal Structure Of The Heterodimeric Ecdysone Rec | 1e-07 | ||
| 3a9e_B | 269 | Crystal Structure Of A Mixed Agonist-Bound Rar-Alph | 2e-07 | ||
| 4dqm_A | 234 | Revealing A Marine Natural Product As A Novel Agoni | 2e-07 | ||
| 1dkf_B | 235 | Crystal Structure Of A Heterodimeric Complex Of Rar | 2e-07 | ||
| 3kmr_A | 266 | Crystal Structure Of Raralpha Ligand Binding Domain | 2e-07 | ||
| 1xap_A | 267 | Structure Of The Ligand Binding Domain Of The Retin | 2e-07 | ||
| 4hn6_A | 114 | Gr Dna Binding Domain R460d/d462r - Tslp Ngre Compl | 2e-07 | ||
| 1xdk_B | 303 | Crystal Structure Of The RarbetaRXRALPHA LIGAND BIN | 2e-07 | ||
| 1dsz_A | 86 | Structure Of The RxrRAR DNA-Binding Domain Heterodi | 3e-07 | ||
| 1dsz_B | 85 | Structure Of The RxrRAR DNA-Binding Domain Heterodi | 3e-07 | ||
| 2c7a_A | 78 | Structure Of The Progesterone Receptor-Dna Complex | 3e-07 | ||
| 1by4_A | 82 | Structure And Mechanism Of The Homodimeric Assembly | 3e-07 | ||
| 4hn5_A | 117 | Gr Dna Binding Domain - Tslp Ngre Complex Length = | 3e-07 | ||
| 1rxr_A | 83 | High Resolution Solution Structure Of The Retinoid | 3e-07 | ||
| 1hra_A | 80 | The Solution Structure Of The Human Retinoic Acid R | 3e-07 | ||
| 2han_B | 119 | Structural Basis Of Heterodimeric Ecdysteroid Recep | 3e-07 | ||
| 3plz_A | 257 | Human Lrh1 Lbd Bound To Gr470 Length = 257 | 3e-07 | ||
| 1yok_A | 256 | Crystal Structure Of Human Lrh-1 Bound With Tif-2 P | 4e-07 | ||
| 1r4i_A | 105 | Crystal Structure Of Androgen Receptor Dna-Binding | 4e-07 | ||
| 1r0n_A | 81 | Crystal Structure Of Heterodimeric Ecdsyone Recepto | 4e-07 | ||
| 3m9e_A | 105 | Thyroid Hormone Beta Dna Binding Domain Homodimer W | 6e-07 | ||
| 2nll_B | 103 | Retinoid X Receptor-Thyroid Hormone Receptor Dna-Bi | 6e-07 | ||
| 1r0n_B | 109 | Crystal Structure Of Heterodimeric Ecdsyone Recepto | 8e-07 | ||
| 1glu_A | 81 | Crystallographic Analysis Of The Interaction Of The | 9e-07 | ||
| 1r4r_B | 92 | Crystallographic Analysis Of The Interaction Of The | 9e-07 | ||
| 1yuc_A | 255 | Human Nuclear Receptor Liver Receptor Homologue-1, | 1e-06 | ||
| 1r4o_A | 92 | Crystallographic Analysis Of The Interaction Of The | 1e-06 | ||
| 1g2n_A | 264 | Crystal Structure Of The Ligand Binding Domain Of T | 1e-06 | ||
| 1zh7_A | 243 | Structural And Biochemical Basis For Selective Repr | 1e-06 | ||
| 1r1k_A | 263 | Crystal Structure Of The Ligand-Binding Domains Of | 1e-06 | ||
| 2nll_A | 66 | Retinoid X Receptor-Thyroid Hormone Receptor Dna-Bi | 2e-06 | ||
| 1pk5_A | 248 | Crystal Structure Of The Orphan Nuclear Receptor Lr | 2e-06 | ||
| 1zdu_A | 245 | The Crystal Structure Of Human Liver Receptor Homol | 2e-06 | ||
| 4dos_A | 242 | Human Nuclear Receptor Liver Receptor Homologue-1, | 2e-06 | ||
| 1ynw_A | 110 | Crystal Structure Of Vitamin D Receptor And 9-Cis R | 4e-06 | ||
| 2gda_A | 72 | Refined Solution Structure Of The Glucocorticoid Re | 4e-06 | ||
| 1gdc_A | 72 | Refined Solution Structure Of The Glucocorticoid Re | 4e-06 | ||
| 1kb2_A | 110 | Crystal Structure Of Vdr Dna-Binding Domain Bound T | 4e-06 | ||
| 3cjw_A | 244 | Crystal Structure Of The Human Coup-Tfii Ligand Bin | 5e-06 | ||
| 3cbb_A | 78 | Crystal Structure Of Hepatocyte Nuclear Factor 4alp | 6e-06 | ||
| 3g9p_B | 90 | Gr Dna Binding Domain:sgk 16bp Complex-7 Length = 9 | 7e-06 | ||
| 3tx7_B | 352 | Crystal Structure Of Lrh-1BETA-Catenin Complex Leng | 9e-06 | ||
| 3g6t_A | 91 | Gr Gamma Dna-Binding Domain:fkbp5 16bp Complex-34 L | 1e-05 | ||
| 2ebl_A | 89 | Solution Structure Of The Zinc Finger, C4-type Doma | 1e-05 | ||
| 1rgd_A | 71 | Structure Refinement Of The Glucocorticoid Receptor | 1e-05 | ||
| 2hbh_A | 302 | Crystal Structure Of Vitamin D Nuclear Receptor Lig | 2e-05 | ||
| 4fhh_A | 300 | Development Of Synthetically Accessible Non-Secoste | 3e-05 | ||
| 3f7d_A | 244 | Sf-1 Lbd Bound By Phosphatidylcholine Length = 244 | 4e-05 | ||
| 1rjk_A | 292 | Crystal Structure Of The Rat Vitamin D Receptor Lig | 5e-05 | ||
| 1ymt_A | 246 | Mouse Sf-1 Lbd Length = 246 | 6e-05 | ||
| 2zl9_A | 271 | 2-Substituted-16-Ene-22-Thia-1alpha,25-Dihydroxy-26 | 6e-05 | ||
| 2zfx_A | 265 | Crystal Structure Of The Rat Vitamin D Receptor Lig | 6e-05 | ||
| 1yow_A | 242 | Human Steroidogenic Factor 1 Lbd With Bound Co-Fact | 7e-05 | ||
| 3p8x_A | 280 | Synthesis, Structure, And Biological Activity Of De | 8e-05 | ||
| 1yp0_A | 239 | Structure Of The Steroidogenic Factor-1 Ligand Bind | 8e-05 | ||
| 1zdt_A | 241 | The Crystal Structure Of Human Steroidogenic Factor | 9e-05 | ||
| 1s0z_A | 263 | Crystal Structure Of The Vdr Lbd Complexed To Seoca | 9e-05 | ||
| 3b0t_A | 254 | Human Vdr Ligand Binding Domain In Complex With Max | 9e-05 | ||
| 3az1_A | 253 | Crystal Structure Analysis Of Vitamin D Receptor Le | 9e-05 | ||
| 3a2i_A | 263 | Crystal Structure Of The Human Vitamin D Receptor ( | 9e-05 | ||
| 3a2j_A | 263 | Crystal Structure Of The Human Vitamin D Receptor ( | 9e-05 | ||
| 3m7r_A | 253 | Crystal Structure Of Vdr H305q Mutant Length = 253 | 9e-05 | ||
| 1db1_A | 259 | Crystal Structure Of The Nuclear Receptor For Vitam | 9e-05 | ||
| 1lv2_A | 229 | Hepatocyte Nuclear Factor 4 Is A Transcription Fact | 1e-04 | ||
| 3fs1_A | 230 | Crystal Structure Of Hnf4a Lbd In Complex With The | 5e-04 | ||
| 1pzl_A | 237 | Crystal Structure Of Hnf4a Lbd In Complex With The | 6e-04 | ||
| 1m7w_A | 250 | Hnf4a Ligand Binding Domain With Bound Fatty Acid L | 7e-04 |
| >pdb|2EWP|A Chain A, Crystal Structure Of Estrogen Related Receptor-3 (Err-Gamma) Ligand Binding Domaind With Tamoxifen Analog Gsk5182 Length = 226 | Back alignment and structure |
|
| >pdb|1KV6|A Chain A, X-Ray Structure Of The Orphan Nuclear Receptor Err3 Ligand- Binding Domain In The Constitutively Active Conformation Length = 230 | Back alignment and structure |
| >pdb|1VJB|A Chain A, Crystal Structure Of The Ligand-Binding Domain Of The Estrogen-Related Receptor Gamma In Complex With 4- Hydroxytamoxifen Length = 251 | Back alignment and structure |
| >pdb|1S9Q|A Chain A, Crystal Structure Of The Ligand-Binding Domain Of The Estrogen-Related Receptor Gamma In Complex With 4-Hydroxytamoxifen Length = 251 | Back alignment and structure |
| >pdb|1S9P|A Chain A, Crystal Structure Of The Ligand-Binding Domain Of The Estrogen-Related Receptor Gamma In Complex With Diethylstilbestrol Length = 227 | Back alignment and structure |
| >pdb|2E2R|A Chain A, Crystal Structure Of Human Estrogen-Related Receptor Gamma Ligand Binding Domain Complex With Bisphenol A Length = 244 | Back alignment and structure |
| >pdb|2PJL|A Chain A, Crystal Structure Of Human Estrogen-Related Receptor Alpha In Complex With A Synthetic Inverse Agonist Reveals Its Novel Molecular Mechanism Length = 247 | Back alignment and structure |
| >pdb|3D24|A Chain A, Crystal Structure Of Ligand-Binding Domain Of Estrogen- Related Receptor Alpha (Erralpha) In Complex With The Peroxisome Proliferators-Activated Receptor Coactivator- 1alpha Box3 Peptide (Pgc-1alpha) Length = 253 | Back alignment and structure |
| >pdb|3K6P|A Chain A, Estrogen Related Receptor Alpha In Complex With An Ether Based Ligand Length = 248 | Back alignment and structure |
| >pdb|1XB7|A Chain A, X-Ray Structure Of Erralpha Lbd In Complex With A Pgc- 1alpha Peptide At 2.5a Resolution Length = 247 | Back alignment and structure |
| >pdb|3DZU|A Chain A, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 467 | Back alignment and structure |
| >pdb|3DZU|A Chain A, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 467 | Back alignment and structure |
| >pdb|1LO1|A Chain A, Estrogen Related Receptor 2 Dna Binding Domain In Complex With Dna Length = 98 | Back alignment and structure |
| >pdb|1LO1|A Chain A, Estrogen Related Receptor 2 Dna Binding Domain In Complex With Dna Length = 98 | Back alignment and structure |
| >pdb|1QKT|A Chain A, Mutant Estrogen Nuclear Receptor Ligand Binding Domain Complexed With Estradiol Length = 248 | Back alignment and structure |
| >pdb|2YAT|A Chain A, Crystal Structure Of Estradiol Derived Metal Chelate And Estrogen Receptor-Ligand Binding Domain Complex Length = 252 | Back alignment and structure |
| >pdb|1UOM|A Chain A, The Structure Of Estrogen Receptor In Complex With A Selective And Potent Tetrahydroisochiolin Ligand. Length = 254 | Back alignment and structure |
| >pdb|1PCG|A Chain A, Helix-Stabilized Cyclic Peptides As Selective Inhibitors Of Steroid Receptor-Coactivator Interactions Length = 244 | Back alignment and structure |
| >pdb|3Q95|B Chain B, Crystal Structure Of Human Estrogen Receptor Alpha Lbd In Complex With Grip Peptide And Estriol Length = 260 | Back alignment and structure |
| >pdb|1ZKY|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With Obcp-3m And A Glucocorticoid Receptor Interacting Protein 1 Nr Box Ii Peptide Length = 257 | Back alignment and structure |
| >pdb|2OCF|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With Estradiol And The E2#23 Fn3 Monobody Length = 298 | Back alignment and structure |
| >pdb|3UU7|B Chain B, Crystal Structure Of Hera-Lbd (Y537s) In Complex With Bisphenol-A Length = 251 | Back alignment and structure |
| >pdb|3HM1|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Ligand-Bi Domain In Complex With A Glucocorticoid Receptor Interactin 1 Nr Box Ii Peptide And Estrone ((8r,9s,13s,14s)-3-Hydroxy- 7,8,9,11,12,14,15, 16-Octahydro-6h-Cyclopenta[a]phenanthren- Length = 253 | Back alignment and structure |
| >pdb|3Q97|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Lbd In Complex With Grip Peptide And Two Isomers Of Ethoxy Triphenylethylene Length = 260 | Back alignment and structure |
| >pdb|3UU7|A Chain A, Crystal Structure Of Hera-Lbd (Y537s) In Complex With Bisphenol-A Length = 251 | Back alignment and structure |
| >pdb|2JFA|B Chain B, Estrogen Receptor Alpha Lbd In Complex With An Affinity- Selected Corepressor Peptide Length = 252 | Back alignment and structure |
| >pdb|1L2I|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With (R,R)-5,11-Cis-Diethyl-5,6,11,12- Tetrahydrochrysene-2,8-Diol And A Glucocorticoid Receptor Interacting Protein 1 Nr Box Ii Peptide Length = 261 | Back alignment and structure |
| >pdb|2QA8|B Chain B, Crystal Structure Of The Estrogen Receptor Alpha Ligand Binding Domain Mutant 537s Complexed With Genistein Length = 258 | Back alignment and structure |
| >pdb|2FSZ|A Chain A, A Second Binding Site For Hydroxytamoxifen Within The Coactivator-Binding Groove Of Estrogen Receptor Beta Length = 246 | Back alignment and structure |
| >pdb|1ERR|A Chain A, Human Estrogen Receptor Ligand-Binding Domain In Complex With Raloxifene Length = 253 | Back alignment and structure |
| >pdb|3UUC|A Chain A, Crystal Structure Of Hera-Lbd (Wt) In Complex With Bisphenol-C Length = 251 | Back alignment and structure |
| >pdb|2QZO|B Chain B, Crystal Structure Of The Estrogen Receptor Alpha Ligand Binding Domain Complexed With Way-169916 Length = 258 | Back alignment and structure |
| >pdb|3Q95|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Lbd In Complex With Grip Peptide And Estriol Length = 260 | Back alignment and structure |
| >pdb|3UUA|A Chain A, Crystal Structure Of Hera-Lbd (Y537s) In Complex With Bisphenol-Af Length = 251 | Back alignment and structure |
| >pdb|3UUA|B Chain B, Crystal Structure Of Hera-Lbd (Y537s) In Complex With Bisphenol-Af Length = 251 | Back alignment and structure |
| >pdb|2BJ4|A Chain A, Estrogen Receptor Alpha Lbd In Complex With A Phage-Display Derived Peptide Antagonist Length = 252 | Back alignment and structure |
| >pdb|1A52|A Chain A, Estrogen Receptor Alpha Ligand-Binding Domain Complexed To Estradiol Length = 258 | Back alignment and structure |
| >pdb|3DT3|A Chain A, Human Estrogen Receptor Alpha Lbd With Gw368 Length = 255 | Back alignment and structure |
| >pdb|3L03|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With A Glucocorticoid Receptor Interacting Protein 1 Nr Box Ii Peptide And Estetrol (Estra-1,3,5(10)-Triene-3,15 Alpha, 16alpha,17beta-Tetrol) Length = 253 | Back alignment and structure |
| >pdb|1ERE|A Chain A, Human Estrogen Receptor Ligand-Binding Domain In Complex With 17beta-Estradiol Length = 253 | Back alignment and structure |
| >pdb|2IOK|A Chain A, Human Estrogen Receptor Alpha Ligand-binding Domain In Complex With Compound 1d Length = 254 | Back alignment and structure |
| >pdb|3ERD|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With Diethylstilbestrol And A Glucocorticoid Receptor Interacting Protein 1 Nr Box Ii Peptide Length = 261 | Back alignment and structure |
| >pdb|2QA8|A Chain A, Crystal Structure Of The Estrogen Receptor Alpha Ligand Binding Domain Mutant 537s Complexed With Genistein Length = 258 | Back alignment and structure |
| >pdb|1GWQ|A Chain A, Human Oestrogen Receptor Alpha Ligand-Binding Domain In Complex With Raloxifene Core And Tif2 Nrbox2 Peptide Length = 248 | Back alignment and structure |
| >pdb|4DMA|A Chain A, Crystal Structure Of Era Lbd In Complex With Ru100132 Length = 247 | Back alignment and structure |
| >pdb|3HLV|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Ligand-Bi Domain In Complex With A Glucocorticoid Receptor Interactin 1 Nr Box Ii Peptide And 16-Alpha-Hydroxy-Estrone ((8s,9r,13 16r)-3,16-Dihydroxy-13-Methyl-7,8,9,11,12,14,15, 16-Octahyd Cyclopenta[a]phenanthren-17-One Length = 253 | Back alignment and structure |
| >pdb|1QKU|A Chain A, Wild Type Estrogen Nuclear Receptor Ligand Binding Domain Complexed With Estradiol Length = 250 | Back alignment and structure |
| >pdb|2P15|A Chain A, Crystal Structure Of The Er Alpha Ligand Binding Domain With The Agonist Ortho-Trifluoromethylphenylvinyl Estradiol Length = 258 | Back alignment and structure |
| >pdb|2QXS|A Chain A, Crystal Structure Of Antagonizing Mutant 536s Of The Estrogen Receptor Alpha Ligand Binding Domain Complexed To Raloxifene Length = 258 | Back alignment and structure |
| >pdb|1GWR|A Chain A, Human Oestrogen Receptor Alpha Ligand-Binding Domain In Complex With 17beta-Oestradiol And Tif2 Nrbox3 Peptide Length = 245 | Back alignment and structure |
| >pdb|2IOG|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With Compound 11f Length = 246 | Back alignment and structure |
| >pdb|1G50|A Chain A, Crystal Structure Of A Wild Type Her Alpha Lbd At 2.9 Angstrom Resolution Length = 247 | Back alignment and structure |
| >pdb|1SJ0|A Chain A, Human Estrogen Receptor Alpha Ligand-binding Domain In Complex With The Antagonist Ligand 4-d Length = 248 | Back alignment and structure |
| >pdb|1QKN|A Chain A, Rat Oestrogen Receptor Beta Ligand-Binding Domain In Complex With Antagonist Raloxifene Length = 255 | Back alignment and structure |
| >pdb|2J7X|A Chain A, Structure Of Estradiol-bound Estrogen Receptor Beta Lbd In Complex With Lxxll Motif From Ncoa5 Length = 255 | Back alignment and structure |
| >pdb|3LTX|A Chain A, Crystal Structure Of The Pacific Oyster Estrogen Receptor Ligand Binding Domain Length = 243 | Back alignment and structure |
| >pdb|3OS8|A Chain A, Estrogen Receptor Length = 258 | Back alignment and structure |
| >pdb|1NDE|A Chain A, Estrogen Receptor Beta With Selective Triazine Modulator Length = 255 | Back alignment and structure |
| >pdb|2I0G|A Chain A, Benzopyrans Are Selective Estrogen Receptor Beta Agonists (Serbas) With Novel Activity In Models Of Benign Prostatic Hyperplasia Length = 257 | Back alignment and structure |
| >pdb|1QKM|A Chain A, Human Oestrogen Receptor Beta Ligand-Binding Domain In Complex With Partial Agonist Genistein Length = 255 | Back alignment and structure |
| >pdb|2NV7|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With Way-555 Length = 238 | Back alignment and structure |
| >pdb|1ZAF|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With 3-Bromo-6-Hydroxy-2-(4-Hydroxy-Phenyl)-Inden-1-One Length = 238 | Back alignment and structure |
| >pdb|3OLL|A Chain A, Crystal Structure Of Phosphorylated Estrogen Receptor Beta Ligand Binding Domain Length = 240 | Back alignment and structure |
| >pdb|2GIU|A Chain A, Human Estrogen Receptor Beta Ligand-Binding Domain In Complex With Compound 45 Length = 241 | Back alignment and structure |
| >pdb|1L2J|A Chain A, Human Estrogen Receptor Beta Ligand-Binding Domain In Complex With (R, R)-5,11-Cis-Diethyl-5,6,11,12-Tetrahydrochrysene-2, 8-Diol Length = 271 | Back alignment and structure |
| >pdb|1X76|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With Way-697 Length = 240 | Back alignment and structure |
| >pdb|1U9E|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With Way-397 Length = 241 | Back alignment and structure |
| >pdb|2YLY|A Chain A, Sulfonamides As Selective Estrogen Receptor Beta Agonists. Length = 240 | Back alignment and structure |
| >pdb|3OS8|C Chain C, Estrogen Receptor Length = 258 | Back alignment and structure |
| >pdb|1YY4|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With 1-Chloro-6-(4-Hydroxy-Phenyl)-Naphthalen-2-Ol Length = 268 | Back alignment and structure |
| >pdb|1X7E|A Chain A, Crystal Structure Of Estrogen Receptor Alpha Complexed With Way-244 Length = 245 | Back alignment and structure |
| >pdb|3KBA|A Chain A, Progesterone Receptor Bound To Sulfonamide Pyrrolidine Partial Agonist Length = 253 | Back alignment and structure |
| >pdb|1A28|A Chain A, Hormone-Bound Human Progesterone Receptor Ligand-Binding Domain Length = 256 | Back alignment and structure |
| >pdb|1E3K|A Chain A, Human Progesteron Receptor Ligand Binding Domain In Complex With The Ligand Metribolone (R1881) Length = 258 | Back alignment and structure |
| >pdb|3G8O|A Chain A, Progesterone Receptor With Bound Pyrrolidine 1 Length = 263 | Back alignment and structure |
| >pdb|2W8Y|A Chain A, Ru486 Bound To The Progesterone Receptor In A Destabilized Agonistic Conformation Length = 260 | Back alignment and structure |
| >pdb|1SR7|A Chain A, Progesterone Receptor Hormone Binding Domain With Bound Mometasone Furoate Length = 259 | Back alignment and structure |
| >pdb|1SQN|A Chain A, Progesterone Receptor Ligand Binding Domain With Bound Norethindrone Length = 261 | Back alignment and structure |
| >pdb|4FNE|A Chain A, X-Ray Crystal Structure Of The Ancestral 3-Keto Steroid Receptor - Doc Complex Length = 254 | Back alignment and structure |
| >pdb|2Q1H|A Chain A, Ancestral Corticoid Receptor In Complex With Aldosterone Length = 250 | Back alignment and structure |
| >pdb|2Q3Y|A Chain A, Ancestral Corticiod Receptor In Complex With Doc Length = 249 | Back alignment and structure |
| >pdb|3RY9|A Chain A, Crystal Structure Of The Resurrected Ancestral Glucocorticoid Receptor 1 In Complex With Doc Length = 250 | Back alignment and structure |
| >pdb|3H52|A Chain A, Crystal Structure Of The Antagonist Form Of Human Glucocorticoid Receptor Length = 254 | Back alignment and structure |
| >pdb|3CLD|A Chain A, Ligand Binding Domain Of The Glucocorticoid Receptor Complexed With Fluticazone Furoate Length = 259 | Back alignment and structure |
| >pdb|1NHZ|A Chain A, Crystal Structure Of The Antagonist Form Of Glucocorticoid Receptor Length = 280 | Back alignment and structure |
| >pdb|3BQD|A Chain A, Doubling The Size Of The Glucocorticoid Receptor Ligand Binding Pocket By Deacylcortivazol Length = 255 | Back alignment and structure |
| >pdb|3E7C|A Chain A, Glucocorticoid Receptor Lbd Bound To Gsk866 Length = 257 | Back alignment and structure |
| >pdb|3MNE|A Chain A, Crystal Structure Of The Agonist Form Of Mouse Glucocorticoid Receptor Stabilized By F608s Mutation At 1.96a Length = 261 | Back alignment and structure |
| >pdb|3MNO|A Chain A, Crystal Structure Of The Agonist Form Of Mouse Glucocorticoid Receptor Stabilized By (A611v, F608s) Mutations At 1.55a Length = 261 | Back alignment and structure |
| >pdb|3MNP|A Chain A, Crystal Structure Of The Agonist Form Of Mouse Glucocorticoid Receptor Stabilized By (A611v, V708a, E711g) Mutations At 1.50a Length = 261 | Back alignment and structure |
| >pdb|1M2Z|A Chain A, Crystal Structure Of A Dimer Complex Of The Human Glucocorticoid Receptor Ligand-Binding Domain Bound To Dexamethasone And A Tif2 Coactivator Motif Length = 257 | Back alignment and structure |
| >pdb|3VHV|A Chain A, Mineralocorticoid Receptor Ligand-Binding Domain With Non-Steroidal Antagonist Length = 260 | Back alignment and structure |
| >pdb|3VHU|A Chain A, Mineralocorticoid Receptor Ligand-Binding Domain With Spironolactone Length = 294 | Back alignment and structure |
| >pdb|2AA6|A Chain A, Mineralocorticoid Receptor S810l Mutant With Bound Progesterone Length = 275 | Back alignment and structure |
| >pdb|4E2J|A Chain A, X-Ray Crystal Structure Of The Ancestral Glucocorticoid Receptor 2 Ligand Binding Domain In Complex With Mometasone Furoate And Tif-2 Coactivator Fragment Length = 250 | Back alignment and structure |
| >pdb|3GN8|A Chain A, X-Ray Crystal Structure Of Ancgr2 In Complex With Dexamethasone Length = 249 | Back alignment and structure |
| >pdb|2OAX|A Chain A, Crystal Structure Of The S810l Mutant Mineralocorticoid Receptor Associated With Sc9420 Length = 256 | Back alignment and structure |
| >pdb|1Y9R|A Chain A, Crystal Structure Of The Human Mineralocorticoid Receptor Ligand-Binding Domain Bound To Deoxycorticosterone And Harboring The S810l Mutation Responsible For A Severe Form Of Hypertension Length = 255 | Back alignment and structure |
| >pdb|2A3I|A Chain A, Structural And Biochemical Mechanisms For The Specificity Of Hormone Binding And Coactivator Assembly By Mineralocorticoid Receptor Length = 253 | Back alignment and structure |
| >pdb|2Q60|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Polyandrocarpa Misakiensis Rxr In Tetramer In Absence Of Ligand Length = 258 | Back alignment and structure |
| >pdb|1I38|A Chain A, Crystal Structure Of The Rat Androgen Receptor Ligand Binding Domain T877a Mutant Complex With Dihydrotestosterone Length = 260 | Back alignment and structure |
| >pdb|2AX6|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain T877a Mutant In Complex With Hydroxyflutamide Length = 256 | Back alignment and structure |
| >pdb|2AX9|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain In Complex With R-3 Length = 256 | Back alignment and structure |
| >pdb|1I37|A Chain A, Crystal Structure Of The Rat Androgen Receptor Ligand Binding Domain Complex With Dihydrotestosterone Length = 260 | Back alignment and structure |
| >pdb|3RLL|A Chain A, Crystal Structure Of The T877a Androgen Receptor Ligand Binding Domain In Complex With (S)-N-(4-Cyano-3-(Trifluoromethyl)phenyl)-3-(4- Cyanonaphthalen-1-Yloxy)-2-Hydroxy-2-Methylpropanamide Length = 247 | Back alignment and structure |
| >pdb|2Q7K|A Chain A, The Androgen Receptor Prostate Cancer Mutant H874y Ligand Binding Domain Bound With Testosterone And An Ar 20-30 Peptide Length = 257 | Back alignment and structure |
| >pdb|2AA2|A Chain A, Mineralocorticoid Receptor With Bound Aldosterone Length = 275 | Back alignment and structure |
| >pdb|1E3G|A Chain A, Human Androgen Receptor Ligand Binding In Complex With The Ligand Metribolone (R1881) Length = 263 | Back alignment and structure |
| >pdb|1XJ7|A Chain A, Complex Androgen Receptor Lbd And Rac3 Peptide Length = 257 | Back alignment and structure |
| >pdb|1T73|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain In Complex With A Fxxff Motif Length = 269 | Back alignment and structure |
| >pdb|3RLJ|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain In Complex With Sarm S-22 Length = 247 | Back alignment and structure |
| >pdb|1T5Z|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain (Lbd) With Dht And A Peptide Derived From Its Physiological Coactivator Ara70 Length = 251 | Back alignment and structure |
| >pdb|2HVC|A Chain A, The Crystal Structure Of Ligand-Binding Domain (Lbd) Of Human Androgen Receptor In Complex With A Selective Modulator Lgd2226 Length = 250 | Back alignment and structure |
| >pdb|3L3X|A Chain A, Crystal Structure Of Dht-Bound Androgen Receptor In Complex With The First Motif Of Steroid Receptor Coactivator 3 Length = 250 | Back alignment and structure |
| >pdb|2Z4J|A Chain A, Crystal Structure Of Ar Lbd With Shp Peptide Nr Box 2 Length = 248 | Back alignment and structure |
| >pdb|2OZ7|A Chain A, Crystal Structure Of The Human Androgen Receptor T877a Mutant Ligand- Binding Domain With Cyproterone Acetate Length = 249 | Back alignment and structure |
| >pdb|1XOW|A Chain A, Crystal Structure Of The Human Androgen Receptor Ligand Binding Domain Bound With An Androgen Receptor Nh2- Terminal Peptide, Ar20-30, And R1881 Length = 249 | Back alignment and structure |
| >pdb|2AM9|A Chain A, Crystal Structure Of Human Androgen Receptor Ligand Binding Domain In Complex With Testosterone Length = 266 | Back alignment and structure |
| >pdb|1GS4|A Chain A, Structural Basis For The Glucocorticoid Response In A Mutant Human Androgen Receptor (Arccr) Derived From An Androgen-Independent Prostate Cancer Length = 248 | Back alignment and structure |
| >pdb|2ABI|A Chain A, Crystal Structure Of The Human Mineralocorticoid Receptor Ligand-Binding Domain Bound To Deoxycorticosterone Length = 256 | Back alignment and structure |
| >pdb|1Z5X|U Chain U, Hemipteran Ecdysone Receptor Ligand-Binding Domain Complexed With Ponasterone A Length = 262 | Back alignment and structure |
| >pdb|1Z95|A Chain A, Crystal Structure Of The Androgen Receptor Ligand-Binding Domain W741l Mutant Complex With R-Bicalutamide Length = 246 | Back alignment and structure |
| >pdb|1HCQ|A Chain A, The Crystal Structure Of The Estrogen Receptor Dna-Binding Domain Bound To Dna: How Receptors Discriminate Between Their Response Elements Length = 84 | Back alignment and structure |
| >pdb|1HCQ|A Chain A, The Crystal Structure Of The Estrogen Receptor Dna-Binding Domain Bound To Dna: How Receptors Discriminate Between Their Response Elements Length = 84 | Back alignment and structure |
| >pdb|2AX8|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain W741l Mutant In Complex With S-1 Length = 256 | Back alignment and structure |
| >pdb|1LBD|A Chain A, Ligand-Binding Domain Of The Human Nuclear Receptor Rxr-Alpha Length = 282 | Back alignment and structure |
| >pdb|2FF0|A Chain A, Solution Structure Of Steroidogenic Factor 1 Dna Binding Domain Bound To Its Target Sequence In The Inhibin Alpha- Subunit Promoter Length = 102 | Back alignment and structure |
| >pdb|2FF0|A Chain A, Solution Structure Of Steroidogenic Factor 1 Dna Binding Domain Bound To Its Target Sequence In The Inhibin Alpha- Subunit Promoter Length = 102 | Back alignment and structure |
| >pdb|2GL8|A Chain A, Human Retinoic Acid Receptor Rxr-Gamma Ligand-Binding Domain Length = 241 | Back alignment and structure |
| >pdb|2A66|A Chain A, Human Liver Receptor Homologue Dna-Binding Domain (Hlrh-1 Dbd) In Complex With Dsdna From The Hcyp7a1 Promoter Length = 113 | Back alignment and structure |
| >pdb|2A66|A Chain A, Human Liver Receptor Homologue Dna-Binding Domain (Hlrh-1 Dbd) In Complex With Dsdna From The Hcyp7a1 Promoter Length = 113 | Back alignment and structure |
| >pdb|3A9E|A Chain A, Crystal Structure Of A Mixed Agonist-Bound Rar-Alpha And Antagonist- Bound Rxr-Alpha Heterodimer Ligand Binding Domains Length = 240 | Back alignment and structure |
| >pdb|1XDK|A Chain A, Crystal Structure Of The RarbetaRXRALPHA LIGAND BINDING Domain Heterodimer In Complex With 9-Cis Retinoic Acid And A Fragment Of The Trap220 Coactivator Length = 238 | Back alignment and structure |
| >pdb|1DKF|A Chain A, Crystal Structure Of A Heterodimeric Complex Of Rar And Rxr Ligand-Binding Domains Length = 233 | Back alignment and structure |
| >pdb|1XIU|A Chain A, Crystal Structure Of The Agonist-Bound Ligand-Binding Domain Of Biomphalaria Glabrata Rxr Length = 230 | Back alignment and structure |
| >pdb|1RDT|A Chain A, Crystal Structure Of A New Rexinoid Bound To The Rxralpha Ligand Binding Doamin In The RxralphaPPARGAMMA HETERODIMER Length = 242 | Back alignment and structure |
| >pdb|3E94|A Chain A, Crystal Structure Of Rxralpha Ligand Binding Domain In Complex With Tributyltin And A Coactivator Fragment Length = 244 | Back alignment and structure |
| >pdb|3UVV|B Chain B, Crystal Structure Of The Ligand Binding Domains Of The Thyroid Receptor:retinoid X Receptor Complexed With 3,3',5 Triiodo-L- Thyronine And 9-Cis Retinoic Acid Length = 244 | Back alignment and structure |
| >pdb|3EYB|A Chain A, Structural And Functional Insights Into The Ligand Binding Domain Of A Non-Duplicated Rxr From The Invertebrate Chordate Amphioxus Length = 219 | Back alignment and structure |
| >pdb|1HLZ|A Chain A, Crystal Structure Of The Orphan Nuclear Receptor Rev- Erb(Alpha) Dna-Binding Domain Bound To Its Cognate Response Element Length = 94 | Back alignment and structure |
| >pdb|1FBY|A Chain A, Crystal Structure Of The Human Rxr Alpha Ligand Binding Domain Bound To 9-Cis Retinoic Acid Length = 239 | Back alignment and structure |
| >pdb|1XV9|A Chain A, Crystal Structure Of CarRXR HETERODIMER BOUND WITH SRC1 Peptide, Fatty Acid, And 5b-Pregnane-3,20-Dione. Length = 236 | Back alignment and structure |
| >pdb|1FM6|A Chain A, The 2.1 Angstrom Resolution Crystal Structure Of The Heterodimer Of The Human Rxralpha And Ppargamma Ligand Binding Domains Respectively Bound With 9-Cis Retinoic Acid And Rosiglitazone And Co-Activator Peptides. Length = 238 | Back alignment and structure |
| >pdb|3PCU|A Chain A, Crystal Structure Of Human Retinoic X Receptor Alpha Ligand-Binding Domain Complexed With Lx0278 And Src1 Peptide Length = 230 | Back alignment and structure |
| >pdb|1MV9|A Chain A, Crystal Structure Of The Human Rxr Alpha Ligand Binding Domain Bound To The Eicosanoid Dha (Docosa Hexaenoic Acid) And A Coactivator Peptide Length = 240 | Back alignment and structure |
| >pdb|3H0A|A Chain A, Crystal Structure Of Peroxisome Proliferator-Activated Receptor Gamma (Pparg) And Retinoic Acid Receptor Alpha (Rxra) In Complex With 9-Cis Retinoic Acid, Co-Activator Peptide, And A Partial Agonist Length = 228 | Back alignment and structure |
| >pdb|1XLS|A Chain A, Crystal Structure Of The Mouse CarRXR LBD HETERODIMER Bound To Tcpobop And 9cra And A Tif2 Peptide Containg The Third Lxxll Motifs Length = 232 | Back alignment and structure |
| >pdb|3OAP|A Chain A, Crystal Structure Of Human Retinoid X Receptor Alpha-Ligand Binding Domain Complex With 9-Cis Retinoic Acid And The Coactivator Peptide Grip-1 Length = 231 | Back alignment and structure |
| >pdb|1HCP|A Chain A, Dna Recognition By The Oestrogen Receptor: From Solution To The Crystal Length = 76 | Back alignment and structure |
| >pdb|4AA6|E Chain E, The Oestrogen Receptor Recognizes An Imperfectly Palindromic Response Element Through An Alternative Side- Chain Conformation Length = 71 | Back alignment and structure |
| >pdb|4AA6|A Chain A, The Oestrogen Receptor Recognizes An Imperfectly Palindromic Response Element Through An Alternative Side- Chain Conformation Length = 71 | Back alignment and structure |
| >pdb|3DZU|D Chain D, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 419 | Back alignment and structure |
| >pdb|1FCY|A Chain A, Isotype Selectivity Of The Human Retinoic Acid Nuclear Receptor Hrar: The Complex With The RarbetaGAMMA- Selective Retinoid Cd564 Length = 236 | Back alignment and structure |
| >pdb|1CIT|A Chain A, Dna-Binding Mechanism Of The Monomeric Orphan Nuclear Receptor Ngfi-B Length = 89 | Back alignment and structure |
| >pdb|1CIT|A Chain A, Dna-Binding Mechanism Of The Monomeric Orphan Nuclear Receptor Ngfi-B Length = 89 | Back alignment and structure |
| >pdb|1OVL|A Chain A, Crystal Structure Of Nurr1 Lbd Length = 271 | Back alignment and structure |
| >pdb|1FCX|A Chain A, Isotype Selectivity Of The Human Retinoic Acid Nuclear Receptor Hrar: The Complex With The Rargamma-Selective Retinoid Bms184394 Length = 235 | Back alignment and structure |
| >pdb|1EXA|A Chain A, Enantiomer Discrimination Illustrated By Crystal Structures Of The Human Retinoic Acid Receptor Hrargamma Ligand Binding Domain: The Complex With The Active R-Enantiomer Bms270394. Length = 246 | Back alignment and structure |
| >pdb|2LBD|A Chain A, Ligand-Binding Domain Of The Human Retinoic Acid Receptor Gamma Bound To All-Trans Retinoic Acid Length = 267 | Back alignment and structure |
| >pdb|2NXX|A Chain A, Crystal Structure Of The Ligand-Binding Domains Of The T.Castaneum (Coleoptera) Heterodimer Ecrusp Bound To Ponasterone A Length = 235 | Back alignment and structure |
| >pdb|1OVL|B Chain B, Crystal Structure Of Nurr1 Lbd Length = 271 | Back alignment and structure |
| >pdb|1LAT|A Chain A, Glucocorticoid Receptor MutantDNA COMPLEX Length = 82 | Back alignment and structure |
| >pdb|2ENV|A Chain A, Solution Sturcture Of The C4-Type Zinc Finger Domain From Human Peroxisome Proliferator-Activated Receptor Delta Length = 88 | Back alignment and structure |
| >pdb|2QW4|A Chain A, Human Nr4a1 Ligand-Binding Domain Length = 273 | Back alignment and structure |
| >pdb|1H9U|A Chain A, The Structure Of The Human Retinoid-X-Receptor Beta Ligand Binding Domain In Complex With The Specific Synthetic Agonist Lg100268 Length = 224 | Back alignment and structure |
| >pdb|1UHL|A Chain A, Crystal Structure Of The Lxralfa-Rxrbeta Lbd Heterodimer Length = 236 | Back alignment and structure |
| >pdb|3V3E|B Chain B, Crystal Structure Of The Human Nur77 Ligand-Binding Domain Length = 257 | Back alignment and structure |
| >pdb|1YJE|A Chain A, Crystal Structure Of The Rngfi-B Ligand-Binding Domain Length = 264 | Back alignment and structure |
| >pdb|2HAN|A Chain A, Structural Basis Of Heterodimeric Ecdysteroid Receptor Interaction With Natural Response Element Hsp27 Gene Promoter Length = 93 | Back alignment and structure |
| >pdb|1YNW|B Chain B, Crystal Structure Of Vitamin D Receptor And 9-Cis Retinoic Acid Receptor Dna-Binding Domains Bound To A Dr3 Response Element Length = 99 | Back alignment and structure |
| >pdb|1R0O|A Chain A, Crystal Structure Of The Heterodimeric Ecdysone Receptor Dna-Binding Complex Length = 86 | Back alignment and structure |
| >pdb|3A9E|B Chain B, Crystal Structure Of A Mixed Agonist-Bound Rar-Alpha And Antagonist- Bound Rxr-Alpha Heterodimer Ligand Binding Domains Length = 269 | Back alignment and structure |
| >pdb|4DQM|A Chain A, Revealing A Marine Natural Product As A Novel Agonist For Retinoic Acid Receptors With A Unique Binding Mode And Antitumor Activity Length = 234 | Back alignment and structure |
| >pdb|1DKF|B Chain B, Crystal Structure Of A Heterodimeric Complex Of Rar And Rxr Ligand-Binding Domains Length = 235 | Back alignment and structure |
| >pdb|3KMR|A Chain A, Crystal Structure Of Raralpha Ligand Binding Domain In Complex With An Agonist Ligand (Am580) And A Coactivator Fragment Length = 266 | Back alignment and structure |
| >pdb|1XAP|A Chain A, Structure Of The Ligand Binding Domain Of The Retinoic Acid Receptor Beta Length = 267 | Back alignment and structure |
| >pdb|4HN6|A Chain A, Gr Dna Binding Domain R460d/d462r - Tslp Ngre Complex Length = 114 | Back alignment and structure |
| >pdb|1XDK|B Chain B, Crystal Structure Of The RarbetaRXRALPHA LIGAND BINDING Domain Heterodimer In Complex With 9-Cis Retinoic Acid And A Fragment Of The Trap220 Coactivator Length = 303 | Back alignment and structure |
| >pdb|1DSZ|A Chain A, Structure Of The RxrRAR DNA-Binding Domain Heterodimer In Complex With The Retinoic Acid Response Element Dr1 Length = 86 | Back alignment and structure |
| >pdb|1DSZ|B Chain B, Structure Of The RxrRAR DNA-Binding Domain Heterodimer In Complex With The Retinoic Acid Response Element Dr1 Length = 85 | Back alignment and structure |
| >pdb|2C7A|A Chain A, Structure Of The Progesterone Receptor-Dna Complex Length = 78 | Back alignment and structure |
| >pdb|1BY4|A Chain A, Structure And Mechanism Of The Homodimeric Assembly Of The Rxr On Dna Length = 82 | Back alignment and structure |
| >pdb|4HN5|A Chain A, Gr Dna Binding Domain - Tslp Ngre Complex Length = 117 | Back alignment and structure |
| >pdb|1RXR|A Chain A, High Resolution Solution Structure Of The Retinoid X Receptor Dna Binding Domain, Nmr, 20 Structure Length = 83 | Back alignment and structure |
| >pdb|1HRA|A Chain A, The Solution Structure Of The Human Retinoic Acid Receptor- Beta Dna-Binding Domain Length = 80 | Back alignment and structure |
| >pdb|2HAN|B Chain B, Structural Basis Of Heterodimeric Ecdysteroid Receptor Interaction With Natural Response Element Hsp27 Gene Promoter Length = 119 | Back alignment and structure |
| >pdb|3PLZ|A Chain A, Human Lrh1 Lbd Bound To Gr470 Length = 257 | Back alignment and structure |
| >pdb|1YOK|A Chain A, Crystal Structure Of Human Lrh-1 Bound With Tif-2 Peptide And Phosphatidylglycerol Length = 256 | Back alignment and structure |
| >pdb|1R4I|A Chain A, Crystal Structure Of Androgen Receptor Dna-Binding Domain Bound To A Direct Repeat Response Element Length = 105 | Back alignment and structure |
| >pdb|1R0N|A Chain A, Crystal Structure Of Heterodimeric Ecdsyone Receptor Dna Binding Complex Length = 81 | Back alignment and structure |
| >pdb|3M9E|A Chain A, Thyroid Hormone Beta Dna Binding Domain Homodimer With Inverted Palindrome Tre Length = 105 | Back alignment and structure |
| >pdb|2NLL|B Chain B, Retinoid X Receptor-Thyroid Hormone Receptor Dna-Binding Domain Heterodimer Bound To Thyroid Response Element Dna Length = 103 | Back alignment and structure |
| >pdb|1R0N|B Chain B, Crystal Structure Of Heterodimeric Ecdsyone Receptor Dna Binding Complex Length = 109 | Back alignment and structure |
| >pdb|1GLU|A Chain A, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 81 | Back alignment and structure |
| >pdb|1R4R|B Chain B, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 92 | Back alignment and structure |
| >pdb|1YUC|A Chain A, Human Nuclear Receptor Liver Receptor Homologue-1, Lrh-1, Bound To Phospholipid And A Fragment Of Human Shp Length = 255 | Back alignment and structure |
| >pdb|1R4O|A Chain A, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 92 | Back alignment and structure |
| >pdb|1G2N|A Chain A, Crystal Structure Of The Ligand Binding Domain Of The Ultraspiracle Protein Usp, The Ortholog Of Rxrs In Insects Length = 264 | Back alignment and structure |
| >pdb|1ZH7|A Chain A, Structural And Biochemical Basis For Selective Repression Of The Orphan Nuclear Receptor Lrh-1 By Shp Length = 243 | Back alignment and structure |
| >pdb|1R1K|A Chain A, Crystal Structure Of The Ligand-Binding Domains Of The Heterodimer EcrUSP BOUND TO PONASTERONE A Length = 263 | Back alignment and structure |
| >pdb|2NLL|A Chain A, Retinoid X Receptor-Thyroid Hormone Receptor Dna-Binding Domain Heterodimer Bound To Thyroid Response Element Dna Length = 66 | Back alignment and structure |
| >pdb|1PK5|A Chain A, Crystal Structure Of The Orphan Nuclear Receptor Lrh-1 Length = 248 | Back alignment and structure |
| >pdb|1ZDU|A Chain A, The Crystal Structure Of Human Liver Receptor Homologue-1 Length = 245 | Back alignment and structure |
| >pdb|4DOS|A Chain A, Human Nuclear Receptor Liver Receptor Homologue-1, Lrh-1, Bound To Dlpc And A Fragment Of Tif-2 Length = 242 | Back alignment and structure |
| >pdb|1YNW|A Chain A, Crystal Structure Of Vitamin D Receptor And 9-Cis Retinoic Acid Receptor Dna-Binding Domains Bound To A Dr3 Response Element Length = 110 | Back alignment and structure |
| >pdb|2GDA|A Chain A, Refined Solution Structure Of The Glucocorticoid Receptor Dna-Binding Domain Length = 72 | Back alignment and structure |
| >pdb|1GDC|A Chain A, Refined Solution Structure Of The Glucocorticoid Receptor Dna-Binding Domain Length = 72 | Back alignment and structure |
| >pdb|1KB2|A Chain A, Crystal Structure Of Vdr Dna-Binding Domain Bound To Mouse Osteopontin (Spp) Response Element Length = 110 | Back alignment and structure |
| >pdb|3CJW|A Chain A, Crystal Structure Of The Human Coup-Tfii Ligand Binding Domain Length = 244 | Back alignment and structure |
| >pdb|3CBB|A Chain A, Crystal Structure Of Hepatocyte Nuclear Factor 4alpha In Complex With Dna: Diabetes Gene Product Length = 78 | Back alignment and structure |
| >pdb|3G9P|B Chain B, Gr Dna Binding Domain:sgk 16bp Complex-7 Length = 90 | Back alignment and structure |
| >pdb|3TX7|B Chain B, Crystal Structure Of Lrh-1BETA-Catenin Complex Length = 352 | Back alignment and structure |
| >pdb|3G6T|A Chain A, Gr Gamma Dna-Binding Domain:fkbp5 16bp Complex-34 Length = 91 | Back alignment and structure |
| >pdb|2EBL|A Chain A, Solution Structure Of The Zinc Finger, C4-type Domain Of Human Coup Transcription Factor 1 Length = 89 | Back alignment and structure |
| >pdb|1RGD|A Chain A, Structure Refinement Of The Glucocorticoid Receptor-Dna Binding Domain From Nmr Data By Relaxation Matrix Calculations Length = 71 | Back alignment and structure |
| >pdb|2HBH|A Chain A, Crystal Structure Of Vitamin D Nuclear Receptor Ligand Binding Domain Bound To A Locked Side-Chain Analog Of Calcitriol And Src-1 Peptide Length = 302 | Back alignment and structure |
| >pdb|4FHH|A Chain A, Development Of Synthetically Accessible Non-Secosteroidal Hybrid Molecules Combining Vitamin D Receptor Agonism And Histone Deacetylase Inhibition Length = 300 | Back alignment and structure |
| >pdb|3F7D|A Chain A, Sf-1 Lbd Bound By Phosphatidylcholine Length = 244 | Back alignment and structure |
| >pdb|1RJK|A Chain A, Crystal Structure Of The Rat Vitamin D Receptor Ligand Binding Domain Complexed With 2md And A Synthetic Peptide Containing The Nr2 Box Of Drip 205 Length = 292 | Back alignment and structure |
| >pdb|1YMT|A Chain A, Mouse Sf-1 Lbd Length = 246 | Back alignment and structure |
| >pdb|2ZL9|A Chain A, 2-Substituted-16-Ene-22-Thia-1alpha,25-Dihydroxy-26,27- Dimethyl-19-Norvitamin D3 Analogs: Synthesis, Biological Evaluation And Crystal Structure Length = 271 | Back alignment and structure |
| >pdb|2ZFX|A Chain A, Crystal Structure Of The Rat Vitamin D Receptor Ligand Binding Domain Complexed With Yr301 And A Synthetic Peptide Containing The Nr2 Box Of Drip 205 Length = 265 | Back alignment and structure |
| >pdb|1YOW|A Chain A, Human Steroidogenic Factor 1 Lbd With Bound Co-Factor Peptide Length = 242 | Back alignment and structure |
| >pdb|3P8X|A Chain A, Synthesis, Structure, And Biological Activity Of Des-Side Chain Analogues Of 1alpha,25-Dihydroxyvitamin D3 With Substituents At C-18 Length = 280 | Back alignment and structure |
| >pdb|1YP0|A Chain A, Structure Of The Steroidogenic Factor-1 Ligand Binding Domain Bound To Phospholipid And A Shp Peptide Motif Length = 239 | Back alignment and structure |
| >pdb|1ZDT|A Chain A, The Crystal Structure Of Human Steroidogenic Factor-1 Length = 241 | Back alignment and structure |
| >pdb|1S0Z|A Chain A, Crystal Structure Of The Vdr Lbd Complexed To Seocalcitol. Length = 263 | Back alignment and structure |
| >pdb|3B0T|A Chain A, Human Vdr Ligand Binding Domain In Complex With Maxacalcitol Length = 254 | Back alignment and structure |
| >pdb|3AZ1|A Chain A, Crystal Structure Analysis Of Vitamin D Receptor Length = 253 | Back alignment and structure |
| >pdb|3A2I|A Chain A, Crystal Structure Of The Human Vitamin D Receptor (H305f) Ligand Binding Domain Complexed With Tei-9647 Length = 263 | Back alignment and structure |
| >pdb|3A2J|A Chain A, Crystal Structure Of The Human Vitamin D Receptor (H305fH397F) LIGAND Binding Domain Complexed With Tei-9647 Length = 263 | Back alignment and structure |
| >pdb|3M7R|A Chain A, Crystal Structure Of Vdr H305q Mutant Length = 253 | Back alignment and structure |
| >pdb|1DB1|A Chain A, Crystal Structure Of The Nuclear Receptor For Vitamin D Complexed To Vitamin D Length = 259 | Back alignment and structure |
| >pdb|1LV2|A Chain A, Hepatocyte Nuclear Factor 4 Is A Transcription Factor That Constitutively Binds Fatty Acids Length = 229 | Back alignment and structure |
| >pdb|3FS1|A Chain A, Crystal Structure Of Hnf4a Lbd In Complex With The Ligand And The Coactivator Pgc-1a Fragment Length = 230 | Back alignment and structure |
| >pdb|1PZL|A Chain A, Crystal Structure Of Hnf4a Lbd In Complex With The Ligand And The Coactivator Src-1 Peptide Length = 237 | Back alignment and structure |
| >pdb|1M7W|A Chain A, Hnf4a Ligand Binding Domain With Bound Fatty Acid Length = 250 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 312 | |||
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 2e-52 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 8e-17 | |
| 3k6p_A | 248 | Steroid hormone receptor ERR1; estrogen related re | 2e-45 | |
| 1lbd_A | 282 | RXR_LBD, retinoid X receptor; transcription factor | 6e-45 | |
| 2e2r_A | 244 | Estrogen-related receptor gamma; ERR gamma, BPA, n | 4e-44 | |
| 3ltx_A | 243 | Estrogen receptor; constitutive, nuclear receptor, | 5e-43 | |
| 2ocf_A | 298 | Estrogen receptor; estrogen receptor, LBD, monobod | 4e-41 | |
| 1xpc_A | 248 | Estrogen receptor; nuclear receptor, transcription | 5e-41 | |
| 1ovl_A | 271 | Orphan nuclear receptor NURR1 (MSe 414, 496, 511); | 1e-40 | |
| 3oll_A | 240 | Estrogen receptor beta; steroid binding, phosphory | 3e-38 | |
| 3plz_A | 257 | FTZ-F1 related protein; alpha helical sandwhich, f | 9e-37 | |
| 2p1t_A | 240 | Retinoic acid receptor RXR-alpha; protein-ligand c | 2e-36 | |
| 3mnp_A | 261 | Glucocorticoid receptor; protein-ligand complex, s | 4e-36 | |
| 1l2j_A | 271 | Estrogen receptor beta; nuclear receptor, transcri | 4e-36 | |
| 2iz2_A | 243 | FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc | 5e-36 | |
| 2nxx_A | 235 | Ultraspiracle (USP, NR2B4); hormone receptor, APO | 2e-35 | |
| 3vhu_A | 294 | Mineralocorticoid receptor; nuclear receptor, tran | 3e-35 | |
| 1yye_A | 268 | ER-beta, estrogen receptor beta; ER-beta, nuclear | 4e-34 | |
| 1pzl_A | 237 | Hepatocyte nuclear factor 4-alpha; transcription; | 4e-34 | |
| 3dzy_D | 419 | Peroxisome proliferator-activated receptor gamma; | 4e-34 | |
| 3dzy_D | 419 | Peroxisome proliferator-activated receptor gamma; | 2e-12 | |
| 3vhv_A | 260 | Mineralocorticoid receptor; nuclear receptor, tran | 7e-34 | |
| 1sqn_A | 261 | PR, progesterone receptor; nuclear receptor, stero | 2e-33 | |
| 1z5x_E | 310 | Ecdysone receptor ligand binding domain; ponastero | 2e-32 | |
| 3cjw_A | 244 | COUP transcription factor 2; COUP-TFII, nuclear re | 2e-32 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 5e-32 | |
| 1g2n_A | 264 | Ultraspiracle protein; antiparallel alpha-helical | 6e-32 | |
| 1xdk_B | 303 | RAR-beta, retinoic acid receptor, beta; nuclear re | 8e-32 | |
| 1t7r_A | 269 | Androgen receptor; nuclear receptor, transcription | 6e-31 | |
| 1ymt_A | 246 | Steroidogenic factor 1; SF-1, ligand-binding domai | 9e-29 | |
| 1yje_A | 264 | Orphan nuclear receptor NR4A1; NGFI-B, NUR77, liga | 2e-27 | |
| 2hc4_A | 302 | Vitamin D receptor; alpha helical sandwich, gene r | 2e-26 | |
| 1hg4_A | 279 | Ultraspiracle; nuclear hormone receptor, transcrip | 3e-26 | |
| 1lo1_A | 98 | Steroid hormone receptor ERR2; estrogen related re | 7e-26 | |
| 1lo1_A | 98 | Steroid hormone receptor ERR2; estrogen related re | 1e-18 | |
| 1fcy_A | 236 | RAR-gamma-1, retinoic acid receptor gamma-1; isoty | 2e-25 | |
| 1cit_A | 89 | NGFI-B, protein (orphan nuclear receptor NGFI-B); | 1e-24 | |
| 1cit_A | 89 | NGFI-B, protein (orphan nuclear receptor NGFI-B); | 9e-16 | |
| 2a66_A | 113 | Orphan nuclear receptor NR5A2; protein-DNA complex | 2e-24 | |
| 2a66_A | 113 | Orphan nuclear receptor NR5A2; protein-DNA complex | 2e-16 | |
| 3kmr_A | 266 | Retinoic acid receptor alpha; nuclear receptor tra | 3e-24 | |
| 1pdu_A | 244 | DHR38, nuclear hormone receptor HR38; nuclear rece | 3e-24 | |
| 2nxx_E | 248 | Ecdysone receptor (ECR, NRH1); hormone receptor, A | 7e-23 | |
| 2r40_D | 266 | Ecdysone receptor, 20-hydroxy-ecdysone receptor; n | 9e-23 | |
| 3g9m_A | 90 | Glucocorticoid receptor; glucocorticoid, DNA-bindi | 2e-22 | |
| 3g9m_A | 90 | Glucocorticoid receptor; glucocorticoid, DNA-bindi | 5e-16 | |
| 1r4i_A | 105 | Androgen receptor; AR, steroid receptor, protein-D | 5e-22 | |
| 1r4i_A | 105 | Androgen receptor; AR, steroid receptor, protein-D | 3e-17 | |
| 3n00_A | 245 | REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s | 2e-21 | |
| 3ipq_A | 283 | Oxysterols receptor LXR-alpha; LXR homodimer, LXR | 4e-21 | |
| 3ilz_A | 267 | Thyroid hormone receptor, alpha isoform 1 variant; | 4e-21 | |
| 1kb2_A | 110 | Vitamin D3 receptor; VDR, nuclear receptor, protei | 6e-21 | |
| 1kb2_A | 110 | Vitamin D3 receptor; VDR, nuclear receptor, protei | 3e-16 | |
| 1hcq_A | 84 | Protein (estrogen receptor); protein-DNA complex, | 9e-21 | |
| 1hcq_A | 84 | Protein (estrogen receptor); protein-DNA complex, | 2e-17 | |
| 1ynw_B | 99 | Retinoic acid receptor RXR-alpha, retinoid X recep | 2e-20 | |
| 1ynw_B | 99 | Retinoic acid receptor RXR-alpha, retinoid X recep | 5e-17 | |
| 3cqv_A | 199 | Nuclear receptor subfamily 1 group D member 2; rev | 2e-20 | |
| 2han_A | 93 | Protein ultraspiracle; transcription regulation, t | 3e-20 | |
| 2han_A | 93 | Protein ultraspiracle; transcription regulation, t | 4e-16 | |
| 3p0u_A | 249 | Nuclear receptor subfamily 2 group C member 2; lig | 3e-20 | |
| 1dsz_B | 85 | RXR-alpha, retinoic acid receptor RXR-alpha; RAR, | 4e-20 | |
| 1dsz_B | 85 | RXR-alpha, retinoic acid receptor RXR-alpha; RAR, | 1e-16 | |
| 1dsz_A | 86 | RAR-alpha, retinoic acid receptor alpha; RAR, nucl | 5e-20 | |
| 1dsz_A | 86 | RAR-alpha, retinoic acid receptor alpha; RAR, nucl | 4e-16 | |
| 2han_B | 119 | Ecdysone receptor; transcription regulation, trans | 2e-19 | |
| 2han_B | 119 | Ecdysone receptor; transcription regulation, trans | 6e-15 | |
| 1osh_A | 232 | BIle acid receptor; nuclear receptor, ligand bindi | 4e-19 | |
| 3f5c_B | 268 | Nuclear receptor subfamily 0 group B member 1; tra | 5e-19 | |
| 2o4j_A | 292 | Vitamin D3 receptor; nuclear receptor-ligand compl | 1e-18 | |
| 1a6y_A | 94 | Orphan nuclear receptor NR1D1; orphan receptor, DN | 2e-17 | |
| 1a6y_A | 94 | Orphan nuclear receptor NR1D1; orphan receptor, DN | 4e-17 | |
| 1xvp_B | 246 | Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR | 2e-17 | |
| 2nll_B | 103 | Protein (thyroid hormone receptor); complex (trans | 3e-17 | |
| 2nll_B | 103 | Protein (thyroid hormone receptor); complex (trans | 3e-14 | |
| 2ebl_A | 89 | COUP transcription factor 1; DNA-binding, metal-bi | 1e-16 | |
| 2ebl_A | 89 | COUP transcription factor 1; DNA-binding, metal-bi | 7e-15 | |
| 1nq7_A | 244 | Nuclear receptor ROR-beta; ligand-binding domain, | 3e-16 | |
| 3cbb_A | 78 | HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN | 3e-16 | |
| 3cbb_A | 78 | HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN | 9e-15 | |
| 1n83_A | 270 | Nuclear receptor ROR-alpha; three-layered alpha he | 7e-16 | |
| 3l0l_A | 248 | Nuclear receptor ROR-gamma; nuclear receptor, rorg | 8e-15 | |
| 3b0t_A | 254 | Vitamin D3 receptor; nuclear receptor, transcripti | 1e-14 | |
| 3u9q_A | 269 | Peroxisome proliferator-activated receptor gamma; | 1e-14 | |
| 1nrl_A | 316 | Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- | 1e-13 | |
| 2p54_A | 267 | PPAR-alpha, peroxisome proliferator-activated rece | 7e-13 | |
| 3up3_A | 243 | Acedaf-12; ligand binding domain, nematode, steroi | 3e-11 | |
| 3gyt_A | 244 | Nuclear hormone receptor of the steroid/thyroid ho | 2e-10 |
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
Score = 177 bits (451), Expect = 2e-52
Identities = 77/338 (22%), Positives = 130/338 (38%), Gaps = 75/338 (22%)
Query: 1 NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDLLS 60
++ YTC + DC I+KR+R CQ CR+QKCL GM +E V+ +R RG +
Sbjct: 171 DLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVE---- 226
Query: 61 QQWPPNKSIPSLEENKMLEALLLCEPEMLTVRSETPQSDPT--LQTINSLSDLYDRELVC 118
+ + + ++LEA L EP+ T +P+ + ++ D++L
Sbjct: 227 ---STSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFT 283
Query: 119 IIGWAKQIPGFTDLSLNDQMRLLQSTWAEILTLTIAYRSLPHCAGKIRFASDLVLDERQA 178
++ WAK+IP F++L L+DQ+ LL++ W E+L + ++RS+ I A+ L + A
Sbjct: 284 LVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAV-KDGILLATGLHVHRNSA 342
Query: 179 RECGFSEIYQQVKHSGSLDGIKEEELPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQ 238
G I+ +V EL ++ +
Sbjct: 343 HSAGVGAIFDRVLT----------ELVSKM----------------------RDMQMDKT 370
Query: 239 VYSGYRQTGACGTLVLANSDVK-LDEFSSLKKFRNSILSSLGDCI--------------- 282
R +VL N D K L + ++ R + +SL
Sbjct: 371 ELGCLR------AIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLL 424
Query: 283 -----------YVLRFWSTVHKDGKVLMNKLFVEMLEA 309
L G ++ +EMLEA
Sbjct: 425 LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEA 462
|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} PDB: 1xb7_A 2pjl_A* 3d24_A Length = 248 | Back alignment and structure |
|---|
| >1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Length = 282 | Back alignment and structure |
|---|
| >2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* Length = 244 | Back alignment and structure |
|---|
| >3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} Length = 243 | Back alignment and structure |
|---|
| >2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... Length = 248 | Back alignment and structure |
|---|
| >1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Length = 271 | Back alignment and structure |
|---|
| >3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... Length = 240 | Back alignment and structure |
|---|
| >3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A Length = 257 | Back alignment and structure |
|---|
| >2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... Length = 240 | Back alignment and structure |
|---|
| >3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* Length = 261 | Back alignment and structure |
|---|
| >1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 Length = 271 | Back alignment and structure |
|---|
| >2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 235 | Back alignment and structure |
|---|
| >3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} Length = 294 | Back alignment and structure |
|---|
| >1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* Length = 268 | Back alignment and structure |
|---|
| >1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* Length = 237 | Back alignment and structure |
|---|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Length = 419 | Back alignment and structure |
|---|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Length = 419 | Back alignment and structure |
|---|
| >3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* Length = 260 | Back alignment and structure |
|---|
| >1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* Length = 261 | Back alignment and structure |
|---|
| >1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} Length = 310 | Back alignment and structure |
|---|
| >3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} Length = 244 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* Length = 264 | Back alignment and structure |
|---|
| >1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 Length = 303 | Back alignment and structure |
|---|
| >1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... Length = 269 | Back alignment and structure |
|---|
| >1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* Length = 246 | Back alignment and structure |
|---|
| >1yje_A Orphan nuclear receptor NR4A1; NGFI-B, NUR77, ligand-binding domain, novel coregulator interface, cell-specific; 2.40A {Rattus norvegicus} PDB: 2qw4_A Length = 264 | Back alignment and structure |
|---|
| >2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Length = 302 | Back alignment and structure |
|---|
| >1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 279 | Back alignment and structure |
|---|
| >1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 Length = 98 | Back alignment and structure |
|---|
| >1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 Length = 98 | Back alignment and structure |
|---|
| >1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* Length = 236 | Back alignment and structure |
|---|
| >1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 Length = 89 | Back alignment and structure |
|---|
| >1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 Length = 89 | Back alignment and structure |
|---|
| >2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A Length = 113 | Back alignment and structure |
|---|
| >2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A Length = 113 | Back alignment and structure |
|---|
| >3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* Length = 266 | Back alignment and structure |
|---|
| >1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 244 | Back alignment and structure |
|---|
| >2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 248 | Back alignment and structure |
|---|
| >2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* Length = 266 | Back alignment and structure |
|---|
| >3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... Length = 90 | Back alignment and structure |
|---|
| >3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... Length = 90 | Back alignment and structure |
|---|
| >1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 Length = 105 | Back alignment and structure |
|---|
| >1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 Length = 105 | Back alignment and structure |
|---|
| >3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} Length = 245 | Back alignment and structure |
|---|
| >3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* Length = 283 | Back alignment and structure |
|---|
| >3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... Length = 267 | Back alignment and structure |
|---|
| >1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A Length = 110 | Back alignment and structure |
|---|
| >1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A Length = 110 | Back alignment and structure |
|---|
| >1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A Length = 84 | Back alignment and structure |
|---|
| >1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A Length = 84 | Back alignment and structure |
|---|
| >1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 Length = 99 | Back alignment and structure |
|---|
| >1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 Length = 99 | Back alignment and structure |
|---|
| >3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A Length = 199 | Back alignment and structure |
|---|
| >2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 Length = 93 | Back alignment and structure |
|---|
| >2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 Length = 93 | Back alignment and structure |
|---|
| >3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} Length = 249 | Back alignment and structure |
|---|
| >1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* Length = 85 | Back alignment and structure |
|---|
| >1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* Length = 85 | Back alignment and structure |
|---|
| >1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A Length = 86 | Back alignment and structure |
|---|
| >1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A Length = 86 | Back alignment and structure |
|---|
| >2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B Length = 119 | Back alignment and structure |
|---|
| >2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B Length = 119 | Back alignment and structure |
|---|
| >1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... Length = 232 | Back alignment and structure |
|---|
| >3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} Length = 268 | Back alignment and structure |
|---|
| >2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* Length = 292 | Back alignment and structure |
|---|
| >1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A Length = 94 | Back alignment and structure |
|---|
| >1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A Length = 94 | Back alignment and structure |
|---|
| >1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* Length = 246 | Back alignment and structure |
|---|
| >2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* Length = 103 | Back alignment and structure |
|---|
| >2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* Length = 103 | Back alignment and structure |
|---|
| >2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* Length = 244 | Back alignment and structure |
|---|
| >3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* Length = 270 | Back alignment and structure |
|---|
| >3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} PDB: 3b0w_A* 3kyt_A* 3l0j_A* Length = 248 | Back alignment and structure |
|---|
| >3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... Length = 254 | Back alignment and structure |
|---|
| >3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... Length = 269 | Back alignment and structure |
|---|
| >1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* Length = 316 | Back alignment and structure |
|---|
| >2p54_A PPAR-alpha, peroxisome proliferator-activated receptor alpha; PPAR alpha GW735 SRC1 agonist HDLC, transcription; HET: 735; 1.79A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fei_A* 1i7g_A* 3kdu_A* 3kdt_A* 2rew_A* 1kkq_A* 3g8i_A* 3et1_A* 2znn_A* 3sp6_A* 1k7l_A* 2npa_A* 2xyj_A* 2xyw_A* 2xyx_A* 2q5g_A* 3gwx_A* 3dy6_A* 1gwx_A* 3peq_A* ... Length = 267 | Back alignment and structure |
|---|
| >3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* Length = 243 | Back alignment and structure |
|---|
| >3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* Length = 244 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 312 | |||
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 100.0 | |
| 3dzy_D | 419 | Peroxisome proliferator-activated receptor gamma; | 100.0 | |
| 1lbd_A | 282 | RXR_LBD, retinoid X receptor; transcription factor | 100.0 | |
| 3ltx_A | 243 | Estrogen receptor; constitutive, nuclear receptor, | 99.97 | |
| 1xdk_B | 303 | RAR-beta, retinoic acid receptor, beta; nuclear re | 99.97 | |
| 3k6p_A | 248 | Steroid hormone receptor ERR1; estrogen related re | 99.97 | |
| 2e2r_A | 244 | Estrogen-related receptor gamma; ERR gamma, BPA, n | 99.97 | |
| 1ovl_A | 271 | Orphan nuclear receptor NURR1 (MSe 414, 496, 511); | 99.97 | |
| 3oll_A | 240 | Estrogen receptor beta; steroid binding, phosphory | 99.97 | |
| 2ocf_A | 298 | Estrogen receptor; estrogen receptor, LBD, monobod | 99.96 | |
| 1xpc_A | 248 | Estrogen receptor; nuclear receptor, transcription | 99.96 | |
| 1g2n_A | 264 | Ultraspiracle protein; antiparallel alpha-helical | 99.96 | |
| 3v3e_B | 257 | Nuclear receptor subfamily 4 group A member 1; orp | 99.96 | |
| 1fcy_A | 236 | RAR-gamma-1, retinoic acid receptor gamma-1; isoty | 99.96 | |
| 3plz_A | 257 | FTZ-F1 related protein; alpha helical sandwhich, f | 99.96 | |
| 2nxx_A | 235 | Ultraspiracle (USP, NR2B4); hormone receptor, APO | 99.96 | |
| 1yye_A | 268 | ER-beta, estrogen receptor beta; ER-beta, nuclear | 99.96 | |
| 3kmr_A | 266 | Retinoic acid receptor alpha; nuclear receptor tra | 99.96 | |
| 1l2j_A | 271 | Estrogen receptor beta; nuclear receptor, transcri | 99.96 | |
| 2iz2_A | 243 | FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc | 99.96 | |
| 1pdu_A | 244 | DHR38, nuclear hormone receptor HR38; nuclear rece | 99.95 | |
| 2p1t_A | 240 | Retinoic acid receptor RXR-alpha; protein-ligand c | 99.95 | |
| 3ilz_A | 267 | Thyroid hormone receptor, alpha isoform 1 variant; | 99.95 | |
| 3vhv_A | 260 | Mineralocorticoid receptor; nuclear receptor, tran | 99.95 | |
| 1ymt_A | 246 | Steroidogenic factor 1; SF-1, ligand-binding domai | 99.95 | |
| 1hg4_A | 279 | Ultraspiracle; nuclear hormone receptor, transcrip | 99.95 | |
| 3mnp_A | 261 | Glucocorticoid receptor; protein-ligand complex, s | 99.95 | |
| 3cjw_A | 244 | COUP transcription factor 2; COUP-TFII, nuclear re | 99.95 | |
| 3f5c_B | 268 | Nuclear receptor subfamily 0 group B member 1; tra | 99.95 | |
| 3p0u_A | 249 | Nuclear receptor subfamily 2 group C member 2; lig | 99.95 | |
| 1sqn_A | 261 | PR, progesterone receptor; nuclear receptor, stero | 99.95 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 99.94 | |
| 1t7r_A | 269 | Androgen receptor; nuclear receptor, transcription | 99.94 | |
| 3vhu_A | 294 | Mineralocorticoid receptor; nuclear receptor, tran | 99.94 | |
| 3ipq_A | 283 | Oxysterols receptor LXR-alpha; LXR homodimer, LXR | 99.94 | |
| 3b0t_A | 254 | Vitamin D3 receptor; nuclear receptor, transcripti | 99.94 | |
| 2r40_D | 266 | Ecdysone receptor, 20-hydroxy-ecdysone receptor; n | 99.94 | |
| 1nq7_A | 244 | Nuclear receptor ROR-beta; ligand-binding domain, | 99.94 | |
| 1xvp_B | 246 | Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR | 99.94 | |
| 1n83_A | 270 | Nuclear receptor ROR-alpha; three-layered alpha he | 99.94 | |
| 3l0l_A | 248 | Nuclear receptor ROR-gamma; nuclear receptor, rorg | 99.93 | |
| 2nxx_E | 248 | Ecdysone receptor (ECR, NRH1); hormone receptor, A | 99.93 | |
| 2o4j_A | 292 | Vitamin D3 receptor; nuclear receptor-ligand compl | 99.93 | |
| 1osh_A | 232 | BIle acid receptor; nuclear receptor, ligand bindi | 99.93 | |
| 1z5x_E | 310 | Ecdysone receptor ligand binding domain; ponastero | 99.93 | |
| 3vi8_A | 273 | Peroxisome proliferator-activated receptor alpha; | 99.93 | |
| 1nrl_A | 316 | Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- | 99.93 | |
| 2hc4_A | 302 | Vitamin D receptor; alpha helical sandwich, gene r | 99.93 | |
| 1pzl_A | 237 | Hepatocyte nuclear factor 4-alpha; transcription; | 99.92 | |
| 3u9q_A | 269 | Peroxisome proliferator-activated receptor gamma; | 99.92 | |
| 3cqv_A | 199 | Nuclear receptor subfamily 1 group D member 2; rev | 99.91 | |
| 3up3_A | 243 | Acedaf-12; ligand binding domain, nematode, steroi | 99.9 | |
| 3n00_A | 245 | REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s | 99.89 | |
| 3gyt_A | 244 | Nuclear hormone receptor of the steroid/thyroid ho | 99.87 | |
| 1lo1_A | 98 | Steroid hormone receptor ERR2; estrogen related re | 99.62 | |
| 3cbb_A | 78 | HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN | 99.6 | |
| 1cit_A | 89 | NGFI-B, protein (orphan nuclear receptor NGFI-B); | 99.6 | |
| 1ynw_B | 99 | Retinoic acid receptor RXR-alpha, retinoid X recep | 99.6 | |
| 1dsz_B | 85 | RXR-alpha, retinoic acid receptor RXR-alpha; RAR, | 99.6 | |
| 2ebl_A | 89 | COUP transcription factor 1; DNA-binding, metal-bi | 99.59 | |
| 2han_A | 93 | Protein ultraspiracle; transcription regulation, t | 99.59 | |
| 1dsz_A | 86 | RAR-alpha, retinoic acid receptor alpha; RAR, nucl | 99.58 | |
| 2a66_A | 113 | Orphan nuclear receptor NR5A2; protein-DNA complex | 99.56 | |
| 1hcq_A | 84 | Protein (estrogen receptor); protein-DNA complex, | 99.54 | |
| 1a6y_A | 94 | Orphan nuclear receptor NR1D1; orphan receptor, DN | 99.53 | |
| 4hn5_A | 117 | Glucocorticoid receptor; glucocorticoid receptor, | 99.51 | |
| 3g9m_A | 90 | Glucocorticoid receptor; glucocorticoid, DNA-bindi | 99.51 | |
| 1kb2_A | 110 | Vitamin D3 receptor; VDR, nuclear receptor, protei | 99.5 | |
| 2han_B | 119 | Ecdysone receptor; transcription regulation, trans | 99.48 | |
| 2lze_A | 87 | A primordial catalytic fold generated by in vitro | 99.48 | |
| 1r4i_A | 105 | Androgen receptor; AR, steroid receptor, protein-D | 99.45 | |
| 2nll_B | 103 | Protein (thyroid hormone receptor); complex (trans | 99.45 | |
| 1dsz_A | 86 | RAR-alpha, retinoic acid receptor alpha; RAR, nucl | 98.91 | |
| 1ynw_B | 99 | Retinoic acid receptor RXR-alpha, retinoid X recep | 98.89 | |
| 1dsz_B | 85 | RXR-alpha, retinoic acid receptor RXR-alpha; RAR, | 98.89 | |
| 3cbb_A | 78 | HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN | 98.89 | |
| 1hcq_A | 84 | Protein (estrogen receptor); protein-DNA complex, | 98.88 | |
| 1cit_A | 89 | NGFI-B, protein (orphan nuclear receptor NGFI-B); | 98.87 | |
| 2ebl_A | 89 | COUP transcription factor 1; DNA-binding, metal-bi | 98.87 | |
| 2han_A | 93 | Protein ultraspiracle; transcription regulation, t | 98.87 | |
| 3g9m_A | 90 | Glucocorticoid receptor; glucocorticoid, DNA-bindi | 98.86 | |
| 1lo1_A | 98 | Steroid hormone receptor ERR2; estrogen related re | 98.86 | |
| 1kb2_A | 110 | Vitamin D3 receptor; VDR, nuclear receptor, protei | 98.84 | |
| 2nll_B | 103 | Protein (thyroid hormone receptor); complex (trans | 98.82 | |
| 1r4i_A | 105 | Androgen receptor; AR, steroid receptor, protein-D | 98.81 | |
| 2a66_A | 113 | Orphan nuclear receptor NR5A2; protein-DNA complex | 98.81 | |
| 2han_B | 119 | Ecdysone receptor; transcription regulation, trans | 98.81 | |
| 1a6y_A | 94 | Orphan nuclear receptor NR1D1; orphan receptor, DN | 98.79 | |
| 4hn5_A | 117 | Glucocorticoid receptor; glucocorticoid receptor, | 98.76 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 98.48 | |
| 3dzy_D | 419 | Peroxisome proliferator-activated receptor gamma; | 98.44 |
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=4e-44 Score=337.49 Aligned_cols=260 Identities=29% Similarity=0.494 Sum_probs=193.5
Q ss_pred CceeEcCCCCCcccccccccccccCchhHHHHhccccccccccccccccccccCCCCCccCCCCCCCCCCchhHHHHHHH
Q psy11505 1 NIEYTCPASNDCEINKRRRKACQACRFQKCLRKGMLKEGVRLDRVRGGRQKYRRNPDLLSQQWPPNKSIPSLEENKMLEA 80 (312)
Q Consensus 1 ~~~Y~C~~~~~C~i~~~~R~~Cr~CRf~KCl~vGM~~eaVq~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ 80 (312)
++.|+|+++++|.|++..|++||+|||+||++|||++++||.+|++..++.... .... ...........+++.
T Consensus 171 ~~~~~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~vq~~r~~~k~r~~~~---~~~~----~~~~~~~~~~~ll~a 243 (467)
T 3dzy_A 171 DLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENE---VEST----SSANEDMPVERILEA 243 (467)
T ss_dssp TCCCCCSSSSCCCCCSSSSSSCHHHHHHHHHHTTCCGGGCCCCSCCCCCCSCSS---CTTS----TTCSCSSCHHHHHHH
T ss_pred CCceeCCCCCCCCCCcccccccccchhhhhhhccccchhhhccccccccccccc---cccc----cccCCCCchhhhhhh
Confidence 457999999999999999999999999999999999999999997654322110 1000 001111223445544
Q ss_pred HHhcCcccccccCC--CCCCCchhHHHhhHHHHHHHHHHHHHHHHhhCCccccCChHHHHHHHHHHHHHHHHHhhhhhcc
Q psy11505 81 LLLCEPEMLTVRSE--TPQSDPTLQTINSLSDLYDRELVCIIGWAKQIPGFTDLSLNDQMRLLQSTWAEILTLTIAYRSL 158 (312)
Q Consensus 81 l~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~l~~~iewak~lp~F~~L~~~DQi~LLK~~~~~~~~L~~a~rs~ 158 (312)
....++........ ..........+..+.++++++++.+|+|||+||+|.+|+.+||++|||++|++++++..|++++
T Consensus 244 ~~~~e~~~~~~~~~~~~~~~~~~~~~~~~l~e~a~~~L~~vVeWAK~iP~F~~L~~~DQi~LLK~~w~elliL~~a~rs~ 323 (467)
T 3dzy_A 244 ELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSI 323 (467)
T ss_dssp HHC----------------------CCTTHHHHHHHHHHHHHHHHHHSTTSTTSCHHHHHHHHHHHHHHHHHHHHHHHTS
T ss_pred hhhhcccchhhhhhcccCCCCcccchHHHHHHHHHHHHHHHHHHHHhCcchhcCCHHHHHHHHHhHHHHHHHHHHHHHhc
Confidence 44333322111100 0001111223456788899999999999999999999999999999999999999999999998
Q ss_pred cCCCCeeEecccchhhHHhhhhcccchhhhhh----cccCccCCCCccccCCceeeeeCCCCcccccccccchhHHHHHH
Q psy11505 159 PHCAGKIRFASDLVLDERQARECGFSEIYQQV----KHSGSLDGIKEEELPRRLCLVCGDVASGFHYGVASCEACKAFFK 234 (312)
Q Consensus 159 ~~~~~~l~~~~g~~~~~~~~~~~~~~~~~~~i----~~~~~~L~ld~~E~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~ 234 (312)
...+ .+++++|..+.++.....+..++++++ ...+.+|++|++||
T Consensus 324 ~~~~-~~ll~~g~~i~~~~~~~~~~~~~~~~il~~lv~~l~~L~ld~~E~------------------------------ 372 (467)
T 3dzy_A 324 AVKD-GILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTEL------------------------------ 372 (467)
T ss_dssp SSTT-BCCCSSSCCCBTHHHHTTTCHHHHHHHHHHTHHHHHHHTCCHHHH------------------------------
T ss_pred cCCC-ceEecCCceechhhhhhhcchHHHHHHHHHHHHHHHHhcCCHHHH------------------------------
Confidence 8766 678899988887776666665555544 44555999999999
Q ss_pred HHhhhcccceecCCCCceeecCCCCc-ccchHHHHHHHHHHHHHhHhHHHHH--------------------------hh
Q psy11505 235 RTIQVYSGYRQTGACGTLVLANSDVK-LDEFSSLKKFRNSILSSLGDCIYVL--------------------------RF 287 (312)
Q Consensus 235 ~~~~~~~~~~~~~~~~~~~l~~~~~~-l~~~~~~~~~~~~~~~~l~~~~~~~--------------------------~~ 287 (312)
++|+||+|||||++ |++.++|+++|++++.+|.+|+..+ +.
T Consensus 373 ------------~lLkAIvLfnpd~~gL~~~~~Ve~lQe~~~~aL~~Y~~~~~p~~p~Rf~kLLl~Lp~LRsi~~~~~E~ 440 (467)
T 3dzy_A 373 ------------GCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEH 440 (467)
T ss_dssp ------------HHHHHHHHSCTTSTTCSCHHHHHHHHHHHHHHHHHHHHHHCTTCTTHHHHHHTHHHHHHHHHHHHHHT
T ss_pred ------------HHHHHHHHhCcCCCCCCCHHHHHHHHHHHHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999998 9999999999999999999999765 33
Q ss_pred hhccccCCccchhHHHHHHHhhh
Q psy11505 288 WSTVHKDGKVLMNKLFVEMLEAY 310 (312)
Q Consensus 288 ~~~~~~~~~~~~~~~~~~~~~~~ 310 (312)
+++++++|.+||++||.|||+|-
T Consensus 441 l~~~kl~g~v~i~~Ll~EMl~a~ 463 (467)
T 3dzy_A 441 LFFFKLIGDTPIDTFLMEMLEAP 463 (467)
T ss_dssp TTTTSTTSCCCCCSHHHHCC---
T ss_pred HHHhhccCCccHHHHHHHHHcCC
Confidence 67789999999999999999974
|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A | Back alignment and structure |
|---|
| >1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A | Back alignment and structure |
|---|
| >3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} | Back alignment and structure |
|---|
| >1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xb7_A 2pjl_A* 3d24_A | Back alignment and structure |
|---|
| >2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* | Back alignment and structure |
|---|
| >1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} SCOP: a.123.1.1 PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... | Back alignment and structure |
|---|
| >2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... | Back alignment and structure |
|---|
| >1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* | Back alignment and structure |
|---|
| >3v3e_B Nuclear receptor subfamily 4 group A member 1; orphan nuclear receptor, transcription; 2.06A {Homo sapiens} PDB: 3v3q_A* 2qw4_A 1yje_A | Back alignment and structure |
|---|
| >1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* | Back alignment and structure |
|---|
| >3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A | Back alignment and structure |
|---|
| >2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} | Back alignment and structure |
|---|
| >1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* | Back alignment and structure |
|---|
| >3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* | Back alignment and structure |
|---|
| >1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... | Back alignment and structure |
|---|
| >3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} SCOP: a.123.1.1 PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... | Back alignment and structure |
|---|
| >3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} SCOP: a.123.1.1 PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* 4fne_A* 4fn9_A* | Back alignment and structure |
|---|
| >1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* | Back alignment and structure |
|---|
| >1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} SCOP: a.123.1.1 PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* | Back alignment and structure |
|---|
| >3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} | Back alignment and structure |
|---|
| >3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} | Back alignment and structure |
|---|
| >1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... | Back alignment and structure |
|---|
| >3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} | Back alignment and structure |
|---|
| >3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* | Back alignment and structure |
|---|
| >3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... | Back alignment and structure |
|---|
| >2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* | Back alignment and structure |
|---|
| >1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* | Back alignment and structure |
|---|
| >1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* | Back alignment and structure |
|---|
| >1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* | Back alignment and structure |
|---|
| >3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} SCOP: a.123.1.0 PDB: 3b0w_A* 3kyt_A* 3l0j_A* | Back alignment and structure |
|---|
| >2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} | Back alignment and structure |
|---|
| >2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* | Back alignment and structure |
|---|
| >1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... | Back alignment and structure |
|---|
| >1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} | Back alignment and structure |
|---|
| >3vi8_A Peroxisome proliferator-activated receptor alpha; nuclear receptor, protein-ligand complex, PPAR, transcriptio; HET: 13M; 1.75A {Homo sapiens} PDB: 2znn_A* 3et1_A* 3kdu_A* 3kdt_A* 2rew_A* 1i7g_A* 3g8i_A* 1kkq_A* 1k7l_A* 3sp6_A* 2npa_A* 2p54_A* 3fei_A* 3tkm_A* 2znq_A* 2znp_A* 3sp9_A* 3gwx_A* 3dy6_A* 1gwx_A* ... | Back alignment and structure |
|---|
| >1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* | Back alignment and structure |
|---|
| >2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* | Back alignment and structure |
|---|
| >1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* | Back alignment and structure |
|---|
| >3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} SCOP: a.123.1.1 PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... | Back alignment and structure |
|---|
| >3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A | Back alignment and structure |
|---|
| >3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* | Back alignment and structure |
|---|
| >3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* | Back alignment and structure |
|---|
| >1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* | Back alignment and structure |
|---|
| >2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A | Back alignment and structure |
|---|
| >2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A | Back alignment and structure |
|---|
| >1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A | Back alignment and structure |
|---|
| >1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A | Back alignment and structure |
|---|
| >4hn5_A Glucocorticoid receptor; glucocorticoid receptor, steroid receptors, NGRE, repre transcription; HET: DNA; 1.90A {Homo sapiens} PDB: 4hn6_A* | Back alignment and structure |
|---|
| >3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} SCOP: g.39.1.2 PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... | Back alignment and structure |
|---|
| >1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A | Back alignment and structure |
|---|
| >2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B | Back alignment and structure |
|---|
| >2lze_A A primordial catalytic fold generated by in vitro evolution; ligase, de novo protein; NMR {Synthetic construct} | Back alignment and structure |
|---|
| >1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* | Back alignment and structure |
|---|
| >1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A | Back alignment and structure |
|---|
| >1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* | Back alignment and structure |
|---|
| >3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A | Back alignment and structure |
|---|
| >1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} SCOP: g.39.1.2 PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... | Back alignment and structure |
|---|
| >1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A | Back alignment and structure |
|---|
| >2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* | Back alignment and structure |
|---|
| >1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A | Back alignment and structure |
|---|
| >2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B | Back alignment and structure |
|---|
| >1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A | Back alignment and structure |
|---|
| >4hn5_A Glucocorticoid receptor; glucocorticoid receptor, steroid receptors, NGRE, repre transcription; HET: DNA; 1.90A {Homo sapiens} PDB: 4hn6_A* | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* | Back alignment and structure |
|---|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 312 | ||||
| d3d24a1 | 227 | a.123.1.1 (A:194-420) Steroid hormone receptor ERR | 9e-28 | |
| d2e2ra1 | 223 | a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 | 6e-26 | |
| d1xpca_ | 245 | a.123.1.1 (A:) Estrogen receptor alpha {Human (Hom | 5e-25 | |
| d1nhza_ | 247 | a.123.1.1 (A:) Glucocorticoid receptor {Human (Hom | 1e-23 | |
| d2p1ta1 | 230 | a.123.1.1 (A:229-458) Retinoid-X receptor alpha (R | 9e-23 | |
| d1sqna_ | 251 | a.123.1.1 (A:) Progesterone receptor {Human (Homo | 4e-22 | |
| d2j7ya1 | 236 | a.123.1.1 (A:217-452) Estrogen receptor beta {Rat | 5e-22 | |
| d1t7ra_ | 250 | a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan | 2e-21 | |
| d1fcya_ | 236 | a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-g | 1e-20 | |
| d1hg4a_ | 265 | a.123.1.1 (A:) Ultraspiracle protein, usp {Drosoph | 1e-20 | |
| d1pk5a_ | 242 | a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH- | 3e-20 | |
| d1pdua_ | 230 | a.123.1.1 (A:) Nuclear hormone receptor HR38 {Frui | 7e-20 | |
| d1pzla_ | 233 | a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha { | 3e-19 | |
| d1g2na_ | 256 | a.123.1.1 (A:) Ultraspiracle protein, usp {Helioth | 7e-19 | |
| d1ovla_ | 236 | a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Huma | 5e-18 | |
| d1n46a_ | 251 | a.123.1.1 (A:) Thyroid hormone receptor beta (TR-b | 1e-17 | |
| d2qw4a1 | 233 | a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 | 2e-16 | |
| d2r40d1 | 243 | a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid m | 6e-16 | |
| d1lo1a_ | 90 | g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-bi | 7e-16 | |
| d1lo1a_ | 90 | g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-bi | 2e-11 | |
| d1pq9a_ | 239 | a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human | 1e-15 | |
| d2b50b1 | 265 | a.123.1.1 (B:211-475) Peroxisome proliferator-acti | 1e-14 | |
| d1cita_ | 89 | g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-b | 3e-14 | |
| d1cita_ | 89 | g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-b | 4e-10 | |
| d1nrla_ | 292 | a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Ho | 3e-14 | |
| d1n83a_ | 251 | a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha { | 3e-14 | |
| d1osha_ | 231 | a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo | 1e-13 | |
| d2fvja1 | 271 | a.123.1.1 (A:207-477) Peroxisome proliferator acti | 9e-13 | |
| d1dszb_ | 84 | g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA- | 1e-12 | |
| d1dszb_ | 84 | g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA- | 4e-12 | |
| d1nq7a_ | 244 | a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {R | 8e-12 | |
| d2hanb1 | 83 | g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding do | 9e-12 | |
| d2hanb1 | 83 | g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding do | 1e-09 | |
| d1kb2a_ | 89 | g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-bindin | 1e-11 | |
| d1kb2a_ | 89 | g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-bindin | 7e-11 | |
| d1xvpb_ | 246 | a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) | 3e-11 | |
| d1r4ia_ | 74 | g.39.1.2 (A:) Androgen receptor {Rat (Rattus norve | 3e-11 | |
| d1r4ia_ | 74 | g.39.1.2 (A:) Androgen receptor {Rat (Rattus norve | 5e-09 | |
| d1ie9a_ | 255 | a.123.1.1 (A:) Vitamin D nuclear receptor {Human ( | 3e-11 | |
| d1xnxa_ | 232 | a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) | 3e-11 | |
| d1a6ya_ | 78 | g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-b | 6e-11 | |
| d1a6ya_ | 78 | g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-b | 2e-10 | |
| d1dsza_ | 75 | g.39.1.2 (A:) Retinoic acid receptor DNA-binding d | 1e-10 | |
| d1dsza_ | 75 | g.39.1.2 (A:) Retinoic acid receptor DNA-binding d | 2e-09 | |
| d1hcqa_ | 74 | g.39.1.2 (A:) Estrogen receptor DNA-binding domain | 2e-10 | |
| d1hcqa_ | 74 | g.39.1.2 (A:) Estrogen receptor DNA-binding domain | 6e-08 | |
| d1lata_ | 71 | g.39.1.2 (A:) Glucocorticoid receptor DNA-binding | 6e-10 | |
| d1lata_ | 71 | g.39.1.2 (A:) Glucocorticoid receptor DNA-binding | 4e-08 | |
| d2p54a1 | 267 | a.123.1.1 (A:202-468) Peroxisome proliferator acti | 9e-10 | |
| d2nllb_ | 103 | g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) D | 1e-08 | |
| d2nllb_ | 103 | g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) D | 4e-08 |
| >d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 227 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Nuclear receptor ligand-binding domain superfamily: Nuclear receptor ligand-binding domain family: Nuclear receptor ligand-binding domain domain: Steroid hormone receptor ERR1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 105 bits (263), Expect = 9e-28
Identities = 78/243 (32%), Positives = 109/243 (44%), Gaps = 25/243 (10%)
Query: 75 NKMLEALLLCEPEMLTVRSETPQSDPTLQTINSLSDLYDRELVCIIGWAKQIPGFTDLSL 134
N ++ LL+ EPE L + D L + +L DL+DRE+V I WAK IPGF+ LSL
Sbjct: 2 NALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTISWAKSIPGFSSLSL 61
Query: 135 NDQMRLLQSTWAEILTLTIAYRSLPHCAGKIRFASDLVLDERQARECGFSEIYQQVKH-S 193
+DQM +LQS W E+L L +A RSLP ++ FA DLVLDE AR G E+ +
Sbjct: 62 SDQMSVLQSVWMEVLVLGVAQRSLPLQ-DELAFAEDLVLDEEGARAAGLGELGAALLQLV 120
Query: 194 GSLD--GIKEEELPRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQ-----VYSGYRQT 246
L ++ EE + L +A+ + EA + + +
Sbjct: 121 RRLQALRLEREEY---VLLKALALANSDSVHIEDAEAVEQLREALHEALLEYEAGRAGPG 177
Query: 247 GACGTLVLANSDVKLDEFSSLKKFRNSILSSLGDCIYVLRFWSTVHKDGKVLMNKLFVEM 306
G + L VL + V +GKV M+KLF+EM
Sbjct: 178 GGAERRRAGRLLLTLPLLRQT-------------AGKVLAHFYGVKLEGKVPMHKLFLEM 224
Query: 307 LEA 309
LEA
Sbjct: 225 LEA 227
|
| >d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 245 | Back information, alignment and structure |
|---|
| >d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 247 | Back information, alignment and structure |
|---|
| >d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} Length = 230 | Back information, alignment and structure |
|---|
| >d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 | Back information, alignment and structure |
|---|
| >d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} Length = 250 | Back information, alignment and structure |
|---|
| >d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} Length = 236 | Back information, alignment and structure |
|---|
| >d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} Length = 265 | Back information, alignment and structure |
|---|
| >d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 | Back information, alignment and structure |
|---|
| >d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 230 | Back information, alignment and structure |
|---|
| >d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 233 | Back information, alignment and structure |
|---|
| >d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} Length = 256 | Back information, alignment and structure |
|---|
| >d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 236 | Back information, alignment and structure |
|---|
| >d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} Length = 233 | Back information, alignment and structure |
|---|
| >d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} Length = 243 | Back information, alignment and structure |
|---|
| >d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} Length = 239 | Back information, alignment and structure |
|---|
| >d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} Length = 265 | Back information, alignment and structure |
|---|
| >d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 89 | Back information, alignment and structure |
|---|
| >d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 89 | Back information, alignment and structure |
|---|
| >d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} Length = 231 | Back information, alignment and structure |
|---|
| >d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 244 | Back information, alignment and structure |
|---|
| >d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 83 | Back information, alignment and structure |
|---|
| >d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 83 | Back information, alignment and structure |
|---|
| >d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} Length = 246 | Back information, alignment and structure |
|---|
| >d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 74 | Back information, alignment and structure |
|---|
| >d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 74 | Back information, alignment and structure |
|---|
| >d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 255 | Back information, alignment and structure |
|---|
| >d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} Length = 232 | Back information, alignment and structure |
|---|
| >d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 | Back information, alignment and structure |
|---|
| >d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 | Back information, alignment and structure |
|---|
| >d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 267 | Back information, alignment and structure |
|---|
| >d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 312 | |||
| d2e2ra1 | 223 | Orphan nuclear receptor ERR3 {Human (Homo sapiens) | 99.97 | |
| d3d24a1 | 227 | Steroid hormone receptor ERR1 {Human (Homo sapiens | 99.97 | |
| d1g2na_ | 256 | Ultraspiracle protein, usp {Heliothis virescens [T | 99.96 | |
| d1xpca_ | 245 | Estrogen receptor alpha {Human (Homo sapiens) [Tax | 99.96 | |
| d1pk5a_ | 242 | Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus | 99.96 | |
| d1hg4a_ | 265 | Ultraspiracle protein, usp {Drosophila melanogaste | 99.96 | |
| d2p1ta1 | 230 | Retinoid-X receptor alpha (RXR-alpha) {Human (Homo | 99.96 | |
| d1fcya_ | 236 | Retinoic acid receptor gamma (RAR-gamma) {Human (H | 99.96 | |
| d1t7ra_ | 250 | Androgen receptor {Chimpanzee (Pan troglodytes) [T | 99.95 | |
| d2j7ya1 | 236 | Estrogen receptor beta {Rat (Rattus norvegicus) [T | 99.95 | |
| d1sqna_ | 251 | Progesterone receptor {Human (Homo sapiens) [TaxId | 99.95 | |
| d1ovla_ | 236 | Orphan nuclear receptor NURR1 {Human (Homo sapiens | 99.95 | |
| d1pdua_ | 230 | Nuclear hormone receptor HR38 {Fruit fly (Drosophi | 99.95 | |
| d1pzla_ | 233 | Hepatocyte nuclear factor 4-alpha {Human (Homo sap | 99.95 | |
| d1nhza_ | 247 | Glucocorticoid receptor {Human (Homo sapiens) [Tax | 99.94 | |
| d2qw4a1 | 233 | Orphan nuclear receptor NR4A1 {Human (Homo sapiens | 99.94 | |
| d1n46a_ | 251 | Thyroid hormone receptor beta (TR-beta) {Human (Ho | 99.94 | |
| d1pq9a_ | 239 | Oxysterols receptor LXR-beta {Human (Homo sapiens) | 99.94 | |
| d1xvpb_ | 246 | Orphan nuclear receptor NR1I3 (CAR) {Human (Homo s | 99.93 | |
| d2r40d1 | 243 | Ecdysone receptor {Noctuid moth (Heliothis viresce | 99.93 | |
| d1osha_ | 231 | Bile acid receptor FXR {Human (Homo sapiens) [TaxI | 99.92 | |
| d1ie9a_ | 255 | Vitamin D nuclear receptor {Human (Homo sapiens) [ | 99.92 | |
| d1nq7a_ | 244 | Orphan nuclear receptor ROR-beta {Rat (Rattus norv | 99.91 | |
| d1xnxa_ | 232 | Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus mu | 99.91 | |
| d1n83a_ | 251 | Orphan nuclear receptor ROR-alpha {Human (Homo sap | 99.91 | |
| d2fvja1 | 271 | Peroxisome proliferator activated receptor gamma, | 99.91 | |
| d2p54a1 | 267 | Peroxisome proliferator activated receptor alpha, | 99.91 | |
| d1nrla_ | 292 | Pregnane x receptor, PXR {Human (Homo sapiens) [Ta | 99.9 | |
| d2b50b1 | 265 | Peroxisome proliferator-activated receptor delta, | 99.89 | |
| d1lo1a_ | 90 | Steroid hormone receptor Err2 DNA-binding domain { | 99.59 | |
| d2hanb1 | 83 | Ecdysone receptor DNA-binding domain {Fruit fly (D | 99.52 | |
| d1dszb_ | 84 | Retinoid X receptor (RXR-alpha) DNA-binding domain | 99.52 | |
| d1cita_ | 89 | Orphan nuclear receptor NGFI-B DNA-binding domain | 99.51 | |
| d1dsza_ | 75 | Retinoic acid receptor DNA-binding domain {Human ( | 99.49 | |
| d1kb2a_ | 89 | Vitamin D3 receptor, VDR, DNA-binding domain {Huma | 99.48 | |
| d1a6ya_ | 78 | Orphan nuclear receptor reverb DNA-binding domain | 99.46 | |
| d1r4ia_ | 74 | Androgen receptor {Rat (Rattus norvegicus) [TaxId: | 99.41 | |
| d2nllb_ | 103 | Thyroid hormone receptor (TR-beta) DNA-binding dom | 99.38 | |
| d1lata_ | 71 | Glucocorticoid receptor DNA-binding domain {Rat (R | 99.33 | |
| d1hcqa_ | 74 | Estrogen receptor DNA-binding domain {Human and ch | 99.31 | |
| d1dszb_ | 84 | Retinoid X receptor (RXR-alpha) DNA-binding domain | 98.88 | |
| d2nllb_ | 103 | Thyroid hormone receptor (TR-beta) DNA-binding dom | 98.83 | |
| d2hanb1 | 83 | Ecdysone receptor DNA-binding domain {Fruit fly (D | 98.82 | |
| d1r4ia_ | 74 | Androgen receptor {Rat (Rattus norvegicus) [TaxId: | 98.81 | |
| d1kb2a_ | 89 | Vitamin D3 receptor, VDR, DNA-binding domain {Huma | 98.81 | |
| d1a6ya_ | 78 | Orphan nuclear receptor reverb DNA-binding domain | 98.75 | |
| d1hcqa_ | 74 | Estrogen receptor DNA-binding domain {Human and ch | 98.74 | |
| d1lata_ | 71 | Glucocorticoid receptor DNA-binding domain {Rat (R | 98.73 | |
| d1dsza_ | 75 | Retinoic acid receptor DNA-binding domain {Human ( | 98.69 | |
| d1lo1a_ | 90 | Steroid hormone receptor Err2 DNA-binding domain { | 98.66 | |
| d1cita_ | 89 | Orphan nuclear receptor NGFI-B DNA-binding domain | 98.66 |
| >d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Nuclear receptor ligand-binding domain superfamily: Nuclear receptor ligand-binding domain family: Nuclear receptor ligand-binding domain domain: Orphan nuclear receptor ERR3 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97 E-value=3.1e-32 Score=231.64 Aligned_cols=191 Identities=38% Similarity=0.631 Sum_probs=167.4
Q ss_pred HHHHHHHhcCcccccccCCCCCCCchhHHHhhHHHHHHHHHHHHHHHHhhCCccccCChHHHHHHHHHHHHHHHHHhhhh
Q psy11505 76 KMLEALLLCEPEMLTVRSETPQSDPTLQTINSLSDLYDRELVCIIGWAKQIPGFTDLSLNDQMRLLQSTWAEILTLTIAY 155 (312)
Q Consensus 76 ~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~iewak~lp~F~~L~~~DQi~LLK~~~~~~~~L~~a~ 155 (312)
+++.++...+|...........+++....+..++++.++.+..+|+|||++|+|.+|+.+||+.|+|++|+++++++.|+
T Consensus 3 ~~v~~l~~~ep~~~~~~~~~~~~~~~~~~~~~l~~~a~~~l~~~V~waK~lp~F~~L~~~DQi~LLk~~~~el~~L~~a~ 82 (223)
T d2e2ra1 3 KIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVY 82 (223)
T ss_dssp HHHHHHHHTCCCCCCCCCCTTSCCCHHHHHHHHHHHHHHHHHHHHHHHTTSTTGGGSCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHhcCCCcccCCCCCCCCCchhHHHHHHHHHHHHHHHHHHHHHHhCcchhhcCHHHHHHHHHHHHHHHHHHHHHH
Confidence 57788888888766555545555667788999999999999999999999999999999999999999999999999999
Q ss_pred hcccCCCCeeEecccchhhHHhhhhcccchhhhhhccc---CccCCCCccccCCceeeeeCCCCcccccccccchhHHHH
Q psy11505 156 RSLPHCAGKIRFASDLVLDERQARECGFSEIYQQVKHS---GSLDGIKEEELPRRLCLVCGDVASGFHYGVASCEACKAF 232 (312)
Q Consensus 156 rs~~~~~~~l~~~~g~~~~~~~~~~~~~~~~~~~i~~~---~~~L~ld~~E~~~~~c~~~~~~~~~~~~~~~~~~~~~~~ 232 (312)
++.+..+ .+.+++|..+++......+..++.+.+..+ +++|++|++||
T Consensus 83 ~s~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~l~~L~ld~~E~---------------------------- 133 (223)
T d2e2ra1 83 RSLSFED-ELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEF---------------------------- 133 (223)
T ss_dssp HTTTSSS-CEEEETTEEECHHHHHHTTCHHHHHHHHHHHHHHHHHTCCHHHH----------------------------
T ss_pred HhcCCCC-eeeecCCcccchHHhhhccHHHHHHHHHHHHHHHHHcCCCHHHH----------------------------
Confidence 9998876 688899988888877777777766655544 45999999999
Q ss_pred HHHHhhhcccceecCCCCceeecCCCCc-ccchHHHHHHHHHHHHHhHhHHHHH--------------------------
Q psy11505 233 FKRTIQVYSGYRQTGACGTLVLANSDVK-LDEFSSLKKFRNSILSSLGDCIYVL-------------------------- 285 (312)
Q Consensus 233 ~~~~~~~~~~~~~~~~~~~~~l~~~~~~-l~~~~~~~~~~~~~~~~l~~~~~~~-------------------------- 285 (312)
++++||+|||||++ +++.++|+++|+++..||.+|+..+
T Consensus 134 --------------~lLkaivL~~pd~~~L~~~~~I~~~q~~~~~aL~~y~~~~~~~~~~rf~~LL~~Lp~Lr~l~~~~~ 199 (223)
T d2e2ra1 134 --------------VTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAV 199 (223)
T ss_dssp --------------HHHHHHHHHTCCCTTCSCHHHHHHHHHHHHHHHHHHHHHHCTTCTTHHHHHHTTHHHHHHHHHHHH
T ss_pred --------------HHHHHHHHhccCCCCCCCHHHHHHHHHHHHHHHHHHHHhcCCCchhHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999998 9999999999999999999999877
Q ss_pred hhhhccccCCccchhHHHHHHHhh
Q psy11505 286 RFWSTVHKDGKVLMNKLFVEMLEA 309 (312)
Q Consensus 286 ~~~~~~~~~~~~~~~~~~~~~~~~ 309 (312)
.++++++..|.+|+++|+.|||+|
T Consensus 200 e~l~~~~~~~~~~~~~Ll~E~l~a 223 (223)
T d2e2ra1 200 QHFYNIKLEGKVPMHKLFLEMLEA 223 (223)
T ss_dssp HHHHHHHHHCCSCCCHHHHHHHTS
T ss_pred HHHHHhhcCCCCCchHHHHHHHcC
Confidence 235667899999999999999986
|
| >d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} | Back information, alignment and structure |
|---|
| >d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} | Back information, alignment and structure |
|---|
| >d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} | Back information, alignment and structure |
|---|
| >d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|