Diaphorina citri psyllid: psy11515


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MKLEPYLLIEIPRFSTSIQTLMWVPDSFFTALLSGRISSLKDETGAIFIDRDPKVFAIILNYLRTRDIDLKSTDLRTLRHEAEYYGIAPLVKRLVLCEDLNQSSCGDVLFYGYLPPP
cccccEEECcccEEEECcHHHccccccHHHHHHcccccccccccccEEEccccccHHHHHHHccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHcccccccccccccccccc
**LEPYLLIEIPRFSTSIQTLMWVPDSFFTALLSGRISSLKDETGAIFIDRDPKVFAIILNYLRTRDIDLKSTDLRTLRHEAEYYGIAPLVKRLVLCEDLNQSSCGDVLFYGYLP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLEPYLLIEIPRFSTSIQTLMWVPDSFFTALLSGRISSLKDETGAIFIDRDPKVFAIILNYLRTRDIDLKSTDLRTLRHEAEYYGIAPLVKRLVLCEDLNQSSCGDVLFYGYLPPP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
BTB/POZ domain-containing protein KCTD3 confidentQ8BFX3
BTB/POZ domain-containing protein KCTD3 confidentQ9Y597

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:2000112 [BP]regulation of cellular macromolecule biosynthetic processprobableGO:0009889, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0050794, GO:0010556, GO:0065007, GO:0008150, GO:0050789
GO:0019219 [BP]regulation of nucleobase-containing compound metabolic processprobableGO:0080090, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0044260 [BP]cellular macromolecule metabolic processprobableGO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0044238 [BP]primary metabolic processprobableGO:0008150, GO:0008152
GO:0003824 [MF]catalytic activityprobableGO:0003674
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051260 [BP]protein homooligomerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DRZ, chain A
Confidence level:very confident
Coverage over the Query: 2-96
View the alignment between query and template
View the model in PyMOL