Psyllid ID: psy11515

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MKLEPYLLIEIPRFSTSIQTLMWVPDSFFTALLSGRISSLKDETGAIFIDRDPKVFAIILNYLRTRDIDLKSTDLRTLRHEAEYYGIAPLVKRLVLCEDLNQSSCGDVLFYGYLPPP
cccccEEEEcccEEEEEHHHHHcccccHHHHHHcccccccccccccEEEccccccHHHHHHHccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccccccccc
cccEEEEEcccEEEEcccHHccccccHHHHHHHcccccccccccccEEEccccHHHHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHHHccccccccEEEEcccccc
mklepyllieiprfstsiqtlmwvpdSFFTALLSGRIsslkdetgaifidrdPKVFAIILNYLRTrdidlkstdlrTLRHEAEYYGIAPLVKRLVLCedlnqsscgdvlfygylppp
MKLEPYLLIEIPRFSTSIQTLMWVPDSFFTALLSGRISSLKdetgaifidrdpKVFAIILNylrtrdidlkstdlrtlRHEAEYYGIAPLVKRLVLCEDLNQSSCGDVLFYGYLPPP
MKLEPYLLIEIPRFSTSIQTLMWVPDSFFTALLSGRISSLKDETGAIFIDRDPKVFAIILNYLRTRDIDLKSTDLRTLRHEAEYYGIAPLVKRLVLCEDLNQSSCGDVLFYGYLPPP
****PYLLIEIPRFSTSIQTLMWVPDSFFTALLSGRISSLKDETGAIFIDRDPKVFAIILNYLRTRDIDLKSTDLRTLRHEAEYYGIAPLVKRLVLCEDLNQSSCGDVLFYGYL***
**LEPYLLIEIPRFSTSIQTLMWVPDSFFTALLSGRISSLKDETGAIFIDRDPKVFAIILNYLRTRDIDLKSTDLRTLRHEAEYYGIAPLVKRLV***************YG*LP**
MKLEPYLLIEIPRFSTSIQTLMWVPDSFFTALLSGRISSLKDETGAIFIDRDPKVFAIILNYLRTRDIDLKSTDLRTLRHEAEYYGIAPLVKRLVLCEDLNQSSCGDVLFYGYLPPP
*KLEPYLLIEIPRFSTSIQTLMWVPDSFFTALLSGRISSLKDETGAIFIDRDPKVFAIILNYLRTRDIDLKSTDLRTLRHEAEYYGIAPLVKRLVLCEDLNQSSCGDVLFYGYLPPP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLEPYLLIEIPRFSTSIQTLMWVPDSFFTALLSGRISSLKDETGAIFIDRDPKVFAIILNYLRTRDIDLKSTDLRTLRHEAEYYGIAPLVKRLVLCEDLNQSSCGDVLFYGYLPPP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query117 2.2.26 [Sep-21-2011]
Q8BFX3 815 BTB/POZ domain-containing yes N/A 0.897 0.128 0.723 6e-45
Q9Y597 815 BTB/POZ domain-containing yes N/A 0.897 0.128 0.723 6e-45
A3KMV1 704 SH3KBP1-binding protein 1 no N/A 0.897 0.149 0.685 3e-39
Q8TBC3 707 SH3KBP1-binding protein 1 no N/A 0.897 0.148 0.685 6e-39
P0C5J9 704 SH3KBP1-binding protein 1 no N/A 0.897 0.149 0.676 1e-38
Q6P7W2 704 SH3KBP1-binding protein 1 no N/A 0.897 0.149 0.676 1e-38
Q3URF8 260 BTB/POZ domain-containing no N/A 0.692 0.311 0.433 6e-13
Q4G0X4 260 BTB/POZ domain-containing no N/A 0.692 0.311 0.433 7e-13
Q6DG99 237 BTB/POZ domain-containing no N/A 0.692 0.341 0.433 1e-10
B1WC97 289 BTB/POZ domain-containing no N/A 0.692 0.280 0.378 6e-09
>sp|Q8BFX3|KCTD3_MOUSE BTB/POZ domain-containing protein KCTD3 OS=Mus musculus GN=Kctd3 PE=2 SV=1 Back     alignment and function desciption
 Score =  179 bits (453), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 76/105 (72%), Positives = 93/105 (88%)

Query: 13  RFSTSIQTLMWVPDSFFTALLSGRISSLKDETGAIFIDRDPKVFAIILNYLRTRDIDLKS 72
           RFSTS QTLMW+PDSFF++LLSGRIS+L+DETGAIFIDRDP  FA ILN+LRT+++DL+ 
Sbjct: 28  RFSTSRQTLMWIPDSFFSSLLSGRISTLRDETGAIFIDRDPAAFAPILNFLRTKELDLRG 87

Query: 73  TDLRTLRHEAEYYGIAPLVKRLVLCEDLNQSSCGDVLFYGYLPPP 117
             +  LRHEAE+YGI PLV+RL+LCE+L +SSCG VLF+GYLPPP
Sbjct: 88  VSINVLRHEAEFYGITPLVRRLLLCEELERSSCGSVLFHGYLPPP 132

Mus musculus (taxid: 10090)
>sp|Q9Y597|KCTD3_HUMAN BTB/POZ domain-containing protein KCTD3 OS=Homo sapiens GN=KCTD3 PE=1 SV=2 Back     alignment and function description
>sp|A3KMV1|SHKB1_BOVIN SH3KBP1-binding protein 1 OS=Bos taurus GN=SHKBP1 PE=2 SV=1 Back     alignment and function description
>sp|Q8TBC3|SHKB1_HUMAN SH3KBP1-binding protein 1 OS=Homo sapiens GN=SHKBP1 PE=1 SV=2 Back     alignment and function description
>sp|P0C5J9|SHKB1_RAT SH3KBP1-binding protein 1 OS=Rattus norvegicus GN=Shkbp1 PE=1 SV=1 Back     alignment and function description
>sp|Q6P7W2|SHKB1_MOUSE SH3KBP1-binding protein 1 OS=Mus musculus GN=Shkbp1 PE=1 SV=1 Back     alignment and function description
>sp|Q3URF8|KCD21_MOUSE BTB/POZ domain-containing protein KCTD21 OS=Mus musculus GN=Kctd21 PE=2 SV=1 Back     alignment and function description
>sp|Q4G0X4|KCD21_HUMAN BTB/POZ domain-containing protein KCTD21 OS=Homo sapiens GN=KCTD21 PE=2 SV=1 Back     alignment and function description
>sp|Q6DG99|KCTD6_DANRE BTB/POZ domain-containing protein KCTD6 OS=Danio rerio GN=kctd6 PE=2 SV=1 Back     alignment and function description
>sp|B1WC97|KCTD7_RAT BTB/POZ domain-containing protein KCTD7 OS=Rattus norvegicus GN=Kctd7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query117
383854253 717 PREDICTED: BTB/POZ domain-containing pro 0.897 0.146 0.847 6e-49
350417509 706 PREDICTED: BTB/POZ domain-containing pro 0.897 0.148 0.847 8e-49
328721322 719 PREDICTED: BTB/POZ domain-containing pro 0.897 0.146 0.847 9e-49
332026694 705 BTB/POZ domain-containing protein KCTD3 0.897 0.148 0.838 1e-48
340714163 707 PREDICTED: BTB/POZ domain-containing pro 0.897 0.148 0.838 1e-48
328788455 706 PREDICTED: BTB/POZ domain-containing pro 0.897 0.148 0.847 2e-48
322801386 707 hypothetical protein SINV_02116 [Solenop 0.897 0.148 0.838 2e-48
345495869 691 PREDICTED: LOW QUALITY PROTEIN: BTB/POZ 0.897 0.151 0.819 2e-48
380025991 713 PREDICTED: LOW QUALITY PROTEIN: BTB/POZ 0.897 0.147 0.847 3e-48
307176287 626 BTB/POZ domain-containing protein KCTD3 0.897 0.167 0.838 2e-47
>gi|383854253|ref|XP_003702636.1| PREDICTED: BTB/POZ domain-containing protein KCTD3-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  197 bits (501), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 89/105 (84%), Positives = 97/105 (92%)

Query: 13  RFSTSIQTLMWVPDSFFTALLSGRISSLKDETGAIFIDRDPKVFAIILNYLRTRDIDLKS 72
           RFSTS QTL WVPDSFFTALLS RI+S +DE GA+FIDRDPK+F IILNYLRT+DIDLK+
Sbjct: 21  RFSTSKQTLTWVPDSFFTALLSNRIASQRDEIGALFIDRDPKLFCIILNYLRTKDIDLKN 80

Query: 73  TDLRTLRHEAEYYGIAPLVKRLVLCEDLNQSSCGDVLFYGYLPPP 117
            DLRTLRHEAEYYGI PLVKRL+LCEDL+QSSCGDVLFYGYLPPP
Sbjct: 81  VDLRTLRHEAEYYGITPLVKRLILCEDLSQSSCGDVLFYGYLPPP 125

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350417509|ref|XP_003491457.1| PREDICTED: BTB/POZ domain-containing protein KCTD3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328721322|ref|XP_001946003.2| PREDICTED: BTB/POZ domain-containing protein KCTD3-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|332026694|gb|EGI66803.1| BTB/POZ domain-containing protein KCTD3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340714163|ref|XP_003395601.1| PREDICTED: BTB/POZ domain-containing protein KCTD3-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328788455|ref|XP_394892.4| PREDICTED: BTB/POZ domain-containing protein KCTD3-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|322801386|gb|EFZ22047.1| hypothetical protein SINV_02116 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|345495869|ref|XP_001600244.2| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein KCTD3-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380025991|ref|XP_003696745.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein KCTD3-like [Apis florea] Back     alignment and taxonomy information
>gi|307176287|gb|EFN65918.1| BTB/POZ domain-containing protein KCTD3 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query117
FB|FBgn0037758 730 CG9467 [Drosophila melanogaste 0.897 0.143 0.761 3.2e-40
UNIPROTKB|H0Y566 213 KCTD3 "BTB/POZ domain-containi 0.888 0.488 0.721 2.9e-39
UNIPROTKB|Q9Y597 815 KCTD3 "BTB/POZ domain-containi 0.897 0.128 0.723 6.2e-39
MGI|MGI:2444629 815 Kctd3 "potassium channel tetra 0.897 0.128 0.723 6.2e-39
RGD|1310658 815 Kctd3 "potassium channel tetra 0.897 0.128 0.723 6.2e-39
UNIPROTKB|E1BNC2 818 LOC100848438 "Uncharacterized 0.897 0.128 0.723 6.3e-39
ZFIN|ZDB-GENE-060503-169 821 kctd3 "potassium channel tetra 0.897 0.127 0.714 3.7e-38
UNIPROTKB|F1PPN4 779 KCTD3 "Uncharacterized protein 0.820 0.123 0.708 3.3e-35
UNIPROTKB|A3KMV1 704 SHKBP1 "SH3KBP1-binding protei 0.897 0.149 0.685 8.2e-35
UNIPROTKB|J9P7U6 665 SHKBP1 "Uncharacterized protei 0.897 0.157 0.685 1.1e-34
FB|FBgn0037758 CG9467 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 434 (157.8 bits), Expect = 3.2e-40, P = 3.2e-40
 Identities = 80/105 (76%), Positives = 92/105 (87%)

Query:    13 RFSTSIQTLMWVPDSFFTALLSGRISSLKDETGAIFIDRDPKVFAIILNYLRTRDIDLKS 72
             RFSTS QTL W+PD+FFTALLSGRISSL+DE  AIFIDRDP +F+IILNYLRT+DID+K+
Sbjct:    21 RFSTSRQTLTWIPDTFFTALLSGRISSLRDEHNAIFIDRDPTLFSIILNYLRTKDIDIKN 80

Query:    73 TDLRTLRHEAEYYGIAPLVKRLVLCEDLNQSSCGDVLFYGYLPPP 117
              ++R LRHEAEYYGI PL KRL LCEDLN SSCGD+LFYG+L  P
Sbjct:    81 CEIRALRHEAEYYGITPLTKRLALCEDLNHSSCGDLLFYGFLAAP 125
GO:0016620 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0051260 "protein homooligomerization" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
UNIPROTKB|H0Y566 KCTD3 "BTB/POZ domain-containing protein KCTD3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y597 KCTD3 "BTB/POZ domain-containing protein KCTD3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2444629 Kctd3 "potassium channel tetramerisation domain containing 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310658 Kctd3 "potassium channel tetramerisation domain containing 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNC2 LOC100848438 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-169 kctd3 "potassium channel tetramerisation domain containing 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PPN4 KCTD3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A3KMV1 SHKBP1 "SH3KBP1-binding protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P7U6 SHKBP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8BFX3KCTD3_MOUSENo assigned EC number0.72380.89740.1288yesN/A
Q9Y597KCTD3_HUMANNo assigned EC number0.72380.89740.1288yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query117
pfam0221492 pfam02214, K_tetra, K+ channel tetramerisation dom 2e-21
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 4e-12
>gnl|CDD|202161 pfam02214, K_tetra, K+ channel tetramerisation domain Back     alignment and domain information 
 Score = 81.1 bits (201), Expect = 2e-21
 Identities = 31/82 (37%), Positives = 38/82 (46%), Gaps = 5/82 (6%)

Query: 13 RFSTSIQTLMWVPDSFFTALLSGRISSLKDETGAIFIDRDPKVFAIILNYLRTRDIDLKS 72
          RF TS  TL   PD+    LL  R     D+T   F DR PK F  ILN+ RT    L  
Sbjct: 9  RFETSKSTLTRFPDTLLGRLLK-RCDFYDDDTNEYFFDRSPKHFETILNFYRT-GGKLHR 66

Query: 73 TD---LRTLRHEAEYYGIAPLV 91
           +   L +   E E+YG+  L 
Sbjct: 67 PEEVCLDSFLEELEFYGLGELA 88

The N-terminal, cytoplasmic tetramerisation domain (T1) of voltage-gated K+ channels encodes molecular determinants for subfamily-specific assembly of alpha-subunits into functional tetrameric channels. It is distantly related to the BTB/POZ domain pfam00651. Length = 92
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 117
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 99.95
KOG2716|consensus 230 99.92
KOG2714|consensus 465 99.91
KOG2715|consensus210 99.88
KOG1665|consensus 302 99.88
KOG2723|consensus221 99.81
KOG3713|consensus 477 99.78
PHA02790 480 Kelch-like protein; Provisional 99.74
PHA02713 557 hypothetical protein; Provisional 99.71
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.68
KOG4441|consensus 571 99.67
KOG4390|consensus 632 99.66
PHA03098 534 kelch-like protein; Provisional 99.64
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.38
KOG1545|consensus 507 99.18
KOG3840|consensus 438 98.76
KOG4350|consensus 620 98.72
KOG2075|consensus 521 98.16
KOG4682|consensus 488 97.91
KOG4591|consensus280 97.64
KOG0783|consensus 1267 97.44
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 96.0
KOG0783|consensus 1267 95.64
PF11822 317 DUF3342: Domain of unknown function (DUF3342); Int 95.6
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 94.57
KOG1724|consensus162 93.34
PF02519100 Auxin_inducible: Auxin responsive protein; InterPr 90.83
KOG3473|consensus112 90.68
KOG2838|consensus 401 87.6
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information 
Probab=99.95  E-value=1.7e-27  Score=151.55  Aligned_cols=90  Identities=40%  Similarity=0.633  Sum_probs=76.0

Q ss_pred             eEEEeCCeEEEeeHhhhccCCCchhhhHHhCc-CCCCCCCCccEEEcCChhhHHHHHHhHhh-Ccccc-CCcCHHHHHHH
Q psy11515          5 PYLLIEIPRFSTSIQTLMWVPDSFFTALLSGR-ISSLKDETGAIFIDRDPKVFAIILNYLRT-RDIDL-KSTDLRTLRHE   81 (117)
Q Consensus         5 V~lnVgG~~F~~~~~tL~~~p~s~f~~~f~~~-~~~~~~~~~~~fidr~p~~F~~IL~flr~-g~l~l-~~~~~~~l~~e   81 (117)
                      |+|||||+.|.|+++||.+.|+|+|++|++.+ .....++++++||||||.+|++||+|+|+ |+++. +......+++|
T Consensus         1 V~lNVGG~~f~~~~~tL~~~~~s~l~~~~~~~~~~~~~~~~~~~fiDRdp~~F~~IL~ylr~~~~l~~~~~~~~~~l~~E   80 (94)
T PF02214_consen    1 VRLNVGGTIFETSRSTLTRYPDSLLARLFSGERSDDYDDDDGEYFIDRDPELFEYILNYLRTGGKLPIPDEICLEELLEE   80 (94)
T ss_dssp             EEEEETTEEEEEEHHHHHTSTTSTTTSHHHTGHGGGEETTTTEEEESS-HHHHHHHHHHHHHTSSB---TTS-HHHHHHH
T ss_pred             CEEEECCEEEEEcHHHHhhCCCChhhhHHhhccccccCCccceEEeccChhhhhHHHHHHhhcCccCCCCchhHHHHHHH
Confidence            78999999999999999999999999999975 44445568999999999999999999999 67776 47789999999


Q ss_pred             HhhcCChhH-HHHH
Q psy11515         82 AEYYGIAPL-VKRL   94 (117)
Q Consensus        82 a~~~~l~~L-~~~~   94 (117)
                      |+||+|.++ ++.|
T Consensus        81 a~fy~l~~l~i~~c   94 (94)
T PF02214_consen   81 AEFYGLDELFIEDC   94 (94)
T ss_dssp             HHHHT-HHHHBHHC
T ss_pred             HHHcCCCccccCCC
Confidence            999999998 7765

They are important in shaping the action potential, and in neuronal excitability and plasticity []. The potassium channel family is composed of several functionally distinct isoforms, which can be broadly separated into 2 groups []: the practically non-inactivating 'delayed' group and the rapidly inactivating 'transient' group. These are all highly similar proteins, with only small amino acid changes causing the diversity of the voltage-dependent gating mechanism, channel conductance and toxin binding properties. Each type of K+ channel is activated by different signals and conditions depending on their type of regulation: some open in response to depolarisation of the plasma membrane; others in response to hyperpolarisation or an increase in intracellular calcium concentration; some can be regulated by binding of a transmitter, together with intracellular kinases; while others are regulated by GTP-binding proteins or other second messengers []. In eukaryotic cells, K+ channels are involved in neural signalling and generation of the cardiac rhythm, act as effectors in signal transduction pathways involving G protein-coupled receptors (GPCRs) and may have a role in target cell lysis by cytotoxic T-lymphocytes []. In prokaryotic cells, they play a role in the maintenance of ionic homeostasis []. All K+ channels discovered so far possess a core of alpha subunits, each comprising either one or two copies of a highly conserved pore loop domain (P-domain). The P-domain contains the sequence (T/SxxTxGxG), which has been termed the K+ selectivity sequence. In families that contain one P-domain, four subunits assemble to form a selective pathway for K+ across the membrane. However, it remains unclear how the 2 P-domain subunits assemble to form a selective pore. The functional diversity of these families can arise through homo- or hetero-associations of alpha subunits or association with auxiliary cytoplasmic beta subunits. K+ channel subunits containing one pore domain can be assigned into one of two superfamilies: those that possess six transmembrane (TM) domains and those that possess only two TM domains. The six TM domain superfamily can be further subdivided into conserved gene families: the voltage-gated (Kv) channels; the KCNQ channels (originally known as KvLQT channels); the EAG-like K+ channels; and three types of calcium (Ca)-activated K+ channels (BK, IK and SK) []. The 2TM domain family comprises inward-rectifying K+ channels. In addition, there are K+ channel alpha-subunits that possess two P-domains. These are usually highly regulated K+ selective leak channels. The Kv family can be divided into several subfamilies on the basis of sequence similarity and function. Four of these subfamilies, Kv1 (Shaker), Kv2 (Shab), Kv3 (Shaw) and Kv4 (Shal), consist of pore-forming alpha subunits that associate with different types of beta subunit. Each alpha subunit comprises six hydrophobic TM domains with a P-domain between the fifth and sixth, which partially resides in the membrane. The fourth TM domain has positively charged residues at every third residue and acts as a voltage sensor, which triggers the conformational change that opens the channel pore in response to a displacement in membrane potential []. More recently, 4 new electrically-silent alpha subunits have been cloned: Kv5 (KCNF), Kv6 (KCNG), Kv8 and Kv9 (KCNS). These subunits do not themselves possess any functional activity, but appear to form heteromeric channels with Kv2 subunits, and thus modulate Shab channel activity []. When highly expressed, they inhibit channel activity, but at lower levels show more specific modulatory actions. The N-terminal, cytoplasmic tetramerization domain (T1) of voltage-gated potassium channels encodes molecular determinants for subfamily-specific assembly of alpha-subunits into functional tetrameric channels []. This domain is found in a subset of a larger group of proteins that contain the BTB/POZ domain.; GO: 0005249 voltage-gated potassium channel activity, 0006813 potassium ion transport, 0008076 voltage-gated potassium channel complex, 0016020 membrane; PDB: 1NN7_A 3KVT_A 1EXB_E 1QDV_A 1DSX_E 1QDW_F 3LUT_B 3LNM_B 2A79_B 3DRY_C ....
>KOG2716|consensus Back     alignment and domain information
>KOG2714|consensus Back     alignment and domain information
>KOG2715|consensus Back     alignment and domain information
>KOG1665|consensus Back     alignment and domain information
>KOG2723|consensus Back     alignment and domain information
>KOG3713|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>KOG4390|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>KOG1545|consensus Back     alignment and domain information
>KOG3840|consensus Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>KOG2075|consensus Back     alignment and domain information
>KOG4682|consensus Back     alignment and domain information
>KOG4591|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>KOG1724|consensus Back     alignment and domain information
>PF02519 Auxin_inducible: Auxin responsive protein; InterPro: IPR003676 This family consists of the protein products of a gene cluster that encodes a group of auxin-regulated RNAs (small auxin up RNAs, SAURs) [] Back     alignment and domain information
>KOG3473|consensus Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query117
3drx_A202 X-Ray Crystal Structure Of Human Kctd5 Protein Crys 6e-08
3drz_A107 X-Ray Crystal Structure Of The N-Terminal Btb Domai 7e-08
>pdb|3DRX|A Chain A, X-Ray Crystal Structure Of Human Kctd5 Protein Crystallized In High- Salt Buffer Length = 202 Back     alignment and structure 
Iteration: 1

 Score = 52.4 bits (124), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 43/82 (52%), Gaps = 3/82 (3%)
Query: 14  FSTSIQTLMWVPDSFFTALLSGR--ISSLKDETGAIFIDRDPKVFAIILNYLRTRDIDL- 70
           F T+ QTL   P SF   L      + S KDETGA  IDRDP  F  +LNYLR   + + 
Sbjct: 23  FLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVIN 82
Query: 71  KSTDLRTLRHEAEYYGIAPLVK 92
           K      +  EAE+Y I  L+K
Sbjct: 83  KDLAEEGVLEEAEFYNITSLIK 104
>pdb|3DRZ|A Chain A, X-Ray Crystal Structure Of The N-Terminal Btb Domain Of Human Kctd5 Protein Length = 107 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query117
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 3e-28
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 1e-26
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 2e-22
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 3e-21
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 3e-21
3kvt_A115 Potassium channel protein SHAW; tetramerization do 2e-20
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 2e-18
2r9r_B 514 Paddle chimera voltage gated potassium channel KV; 7e-05
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
 Score = 98.2 bits (245), Expect = 3e-28
 Identities = 35/85 (41%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 13  RFSTSIQTLMWVPDSFFTALLSGR--ISSLKDETGAIFIDRDPKVFAIILNYLRTRDIDL 70
            F T+ QTL   P SF   L      + S KDETGA  IDRDP  F  +LNYLR   + +
Sbjct: 16  YFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVI 75

Query: 71  -KSTDLRTLRHEAEYYGIAPLVKRL 94
            K      +  EAE+Y I  L+K +
Sbjct: 76  NKDLAEEGVLEEAEFYNITSLIKLV 100
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Length = 202 Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Length = 105 Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Length = 140 Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Length = 124 Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Length = 115 Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Length = 100 Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Length = 514 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query117
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 99.97
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 99.95
3kvt_A115 Potassium channel protein SHAW; tetramerization do 99.95
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 99.95
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 99.95
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 99.95
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 99.94
2r9r_B 514 Paddle chimera voltage gated potassium channel KV; 99.86
3hve_A 256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.73
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.73
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.72
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.72
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.71
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.7
2vpk_A116 Myoneurin; transcription regulation, transcription 99.69
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.69
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.69
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.69
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.69
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 99.68
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.65
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.65
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.64
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.63
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.63
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.59
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.59
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.56
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 98.98
4ajy_C97 Transcription elongation factor B polypeptide 1; E 98.62
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 98.58
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 98.26
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 97.54
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 97.53
2fnj_C96 Transcription elongation factor B polypeptide 1; b 97.5
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 96.52
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
Probab=99.97  E-value=6e-30  Score=166.07  Aligned_cols=95  Identities=37%  Similarity=0.439  Sum_probs=84.6

Q ss_pred             CcceEEEeCCeEEEeeHhhhccCCCchhhhHHhCcCC--CCCCCCccEEEcCChhhHHHHHHhHhhCccccC-CcCHHHH
Q psy11515          2 KLEPYLLIEIPRFSTSIQTLMWVPDSFFTALLSGRIS--SLKDETGAIFIDRDPKVFAIILNYLRTRDIDLK-STDLRTL   78 (117)
Q Consensus         2 ~~~V~lnVgG~~F~~~~~tL~~~p~s~f~~~f~~~~~--~~~~~~~~~fidr~p~~F~~IL~flr~g~l~l~-~~~~~~l   78 (117)
                      +..|+|||||++|.|+++||+++|+|+|++||+++..  ...++++++||||||.+|++||+|||+|+++++ +.+...+
T Consensus         5 ~~~v~LNVGG~~f~t~~~TL~~~p~s~L~~~~~~~~~~~~~~d~~~~~fiDRdp~~F~~IL~~lr~g~l~~p~~~~~~~l   84 (107)
T 3drz_A            5 SKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGV   84 (107)
T ss_dssp             CCEEEEEETTEEEEEEHHHHTSSTTSHHHHHHTTCGGGGGGBCTTSCEEECSCHHHHHHHHHHHHHSCCCCCTTSCHHHH
T ss_pred             CCEEEEEECCEEEEECHHHHhcCCCcchhHHHhcCCCCCcCCCCCceEEecCChHHHHHHHHHhCCCeeCCCCCCCHHHH
Confidence            3579999999999999999999999999999986532  234567999999999999999999999999884 5678999


Q ss_pred             HHHHhhcCChhHHHHHhh
Q psy11515         79 RHEAEYYGIAPLVKRLVL   96 (117)
Q Consensus        79 ~~ea~~~~l~~L~~~~~~   96 (117)
                      ++||+||||++|++.|..
T Consensus        85 ~~Ea~fy~l~~L~~~l~~  102 (107)
T 3drz_A           85 LEEAEFYNITSLIKLVKD  102 (107)
T ss_dssp             HHHHHHHTCHHHHHHHHH
T ss_pred             HHHHHHCCCHHHHHHHHH
Confidence            999999999999999984
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 117
d1nn7a_105 d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus 9e-21
d1t1da_100 d.42.1.2 (A:) Shaker potassium channel {California 1e-19
d3kvta_103 d.42.1.2 (A:) akv3.1 voltage-gated potassium chann 2e-19
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 105 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: Tetramerization domain of potassium channels
domain: Potassium channel kv4.2
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 78.0 bits (192), Expect = 9e-21
 Identities = 25/91 (27%), Positives = 37/91 (40%), Gaps = 3/91 (3%)

Query: 13  RFSTSIQTLMWVPDSFFTALLSGRISSLKDETGAIFIDRDPKVFAIILNYLRTRDIDL-K 71
           RF T   TL   PD+   +    R      ET   F DRDP +F  ILN+ RT  +   +
Sbjct: 10  RFQTWQDTLERYPDTLLGSS--ERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPR 67

Query: 72  STDLRTLRHEAEYYGIAPLVKRLVLCEDLNQ 102
              +     E  ++G+ P +      E+   
Sbjct: 68  HECISAYDEELAFFGLIPEIIGDCCYEEYKD 98
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Length = 100 Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query117
d3kvta_103 akv3.1 voltage-gated potassium channel {California 99.95
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 99.95
d1t1da_100 Shaker potassium channel {California sea hare (Apl 99.94
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.69
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.66
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 96.22
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 96.14
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 91.66
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 87.95
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: Tetramerization domain of potassium channels
domain: akv3.1 voltage-gated potassium channel
species: California sea hare (Aplysia californica) [TaxId: 6500]

Probab=99.95  E-value=1.2e-28  Score=157.50  Aligned_cols=93  Identities=24%  Similarity=0.345  Sum_probs=80.5

Q ss_pred             CcceEEEeCCeEEEeeHhhhccCCCchhhhHHhCcCCCCCCCCccEEEcCChhhHHHHHHhHhhCccccC-CcCHHHHHH
Q psy11515          2 KLEPYLLIEIPRFSTSIQTLMWVPDSFFTALLSGRISSLKDETGAIFIDRDPKVFAIILNYLRTRDIDLK-STDLRTLRH   80 (117)
Q Consensus         2 ~~~V~lnVgG~~F~~~~~tL~~~p~s~f~~~f~~~~~~~~~~~~~~fidr~p~~F~~IL~flr~g~l~l~-~~~~~~l~~   80 (117)
                      +.+|+|||||++|+|+++||.+.|+++|+.+++... ...++++++||||||.+|++||+|||+|+++++ ......+++
T Consensus         1 ~~rI~LNVGG~~F~t~~~tL~~~~~s~l~~~~~~~~-~~~~~~~~~fiDRdp~~F~~IL~ylR~g~l~~p~~~~~~~l~~   79 (103)
T d3kvta_           1 ENRVIINVGGIRHETYKATLKKIPATRLSRLTEGML-NYDPVLNEYFFDRHPGVFAQIINYYRSGKLHYPTDVCGPLFEE   79 (103)
T ss_dssp             CCEEEEEETTEEEEEEHHHHTTSCSSTTTTCCTTST-TEETTTTEEEECSCTTTHHHHHHHHHHSCBCCCSSSCHHHHHH
T ss_pred             CCEEEEEECCEEEEEeHHHHhhCccchhHHHHcCCC-ccCCCCCcEEecCCHHHHHHHHHHHccCCcccccccCHHHHHH
Confidence            357999999999999999999999999999887543 234568899999999999999999999999984 668899999


Q ss_pred             HHhhcCChh-HHHHHh
Q psy11515         81 EAEYYGIAP-LVKRLV   95 (117)
Q Consensus        81 ea~~~~l~~-L~~~~~   95 (117)
                      ||+||||++ +++.|+
T Consensus        80 Ea~yygi~~~~l~~Cc   95 (103)
T d3kvta_          80 ELEFWGLDSNQVEPCC   95 (103)
T ss_dssp             HHHHHTCCGGGBCGGG
T ss_pred             HHHHcCCCHHHHHHHh
Confidence            999999974 555554
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure