Diaphorina citri psyllid: psy11518


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
KYTLTQTFVTHSHTASVRSVAATSKLAASSGADETVVLYDMVKRKQSGALMQHEGTITCLKFTPEGSHLISCSDDGSIAIFRVGSWQLEKLFKKAHKGTAVNHISIHPSGKLALSVGKDKTLRTWNLVKGRSAYITNLS
ccEEEEEcccccccEEEEEEcccccEEEECcccccEEEEEccccCEEEEcccccccEEEEEEcccccEEEEECccccEEEEEccccEEEEEEccccccccEEEEEEcccccEEEECcccccEEEEEcccccEEEEEEcc
KYTLTQTFVTHSHTASVRSVAATSKLAASSGADETVVLYDMVKRKQSGALMQHEGTITCLKFTPEGSHLISCSDDGSIAIFRVGSWQLEKLFKKAHKGTAVNHISIHPSGKLALSVGKDKTLRTWNLVKGRSAYITNLS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KYTLTQTFVTHSHTASVRSVAATSKLAASSGADETVVLYDMVKRKQSGALMQHEGTITCLKFTPEGSHLISCSDDGSIAIFRVGSWQLEKLFKKAHKGTAVNHISIHPSGKLALSVGKDKTLRTWNLVKGRSAYITNLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
p21-activated protein kinase-interacting protein 1 Negatively regulates the PAK1 kinase. The PAK kinase family have been shown to play a positive role in the regulation of signaling by pathways involving MAPK8 and RELA. PAK1 exists as an inactive homodimer, which is activated by binding of small GTPases such as CDC42 to an N-terminal regulatory domain. PAK1IP1 also binds to the N-terminus of PAK1, and inhibits the specific activation of PAK1 by CDC42.confidentQ5EA99
p21-activated protein kinase-interacting protein 1-like Negatively regulates the PAK1 kinase.confidentQ5ZKU8
p21-activated protein kinase-interacting protein 1 Negatively regulates the PAK1 kinase. PAK1 is a member of the PAK kinase family, which have been shown to play a positive role in the regulation of signaling pathways involving MAPK8 and RELA. PAK1 exists as an inactive homodimer, which is activated by binding of small GTPases such as CDC42 to an N-terminal regulatory domain. PAK1IP1 also binds to the N-terminus of PAK1, and inhibits the specific activation of PAK1 by CDC42.confidentQ9NWT1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0032991 [CC]macromolecular complexprobableGO:0005575
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005815 [CC]microtubule organizing centerprobableGO:0005856, GO:0005575, GO:0015630, GO:0043228, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PBI, chain B
Confidence level:very confident
Coverage over the Query: 5-136
View the alignment between query and template
View the model in PyMOL