Psyllid ID: psy11518


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
KYTLTQTFVTHSHTASVRSVAATSKLAASSGADETVVLYDMVKRKQSGALMQHEGTITCLKFTPEGSHLISCSDDGSIAIFRVGSWQLEKLFKKAHKGTAVNHISIHPSGKLALSVGKDKTLRTWNLVKGRSAYITNLS
ccEEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEccccEEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEccccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEcc
cccccEEEEEccccccEEEEcccccEEEEcccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEccccccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEEcc
KYTLTQTFVTHSHTASVRSVAATSKLaassgadeTVVLYDMVKRkqsgalmqhegtitclkftpegshliscsddgsiaIFRVGSWQLEKLFKKAHkgtavnhisihpsgklalsvgkdktlrtwNLVKGRSAYITNLS
kytltqtfvthshtasvrsvaatsklaassgadetVVLYDMVKRKQSGALMQHEGTITCLKFTPEGSHLISCSDDGSIAIFRVGSWQLEKLFKKAHKGTavnhisihpsgklalsvgkdktlrtwnlvkgrsayitnls
KYTLTQTFVTHSHTASVRSVAATSKLAASSGADETVVLYDMVKRKQSGALMQHEGTITCLKFTPEGSHLISCSDDGSIAIFRVGSWQLEKLFKKAHKGTAVNHISIHPSGKLALSVGKDKTLRTWNLVKGRSAYITNLS
*********************************ETVVLYDMVKRKQSGALMQHEGTITCLKFTPEGSHLISCSDDGSIAIFRVGSWQLEKLFKKAHKGTAVNHISIHPSGKLALSVGKDKTLRTWNLVKGRSAYI****
KYTLTQTFVTHSHTASVRSVAATSKLAASSGADETVVLYDMVKRKQSGALMQHEGTITCLKFTPEGSHLISCSDDGSIAIFRVGSWQLEKLFKKAHKGTAVNHISIHPSGKLALSVGKDKTLRTWNLVKGRSAYITNLS
KYTLTQTFVTHSHTASVRSVAATSKLAASSGADETVVLYDMVKRKQSGALMQHEGTITCLKFTPEGSHLISCSDDGSIAIFRVGSWQLEKLFKKAHKGTAVNHISIHPSGKLALSVGKDKTLRTWNLVKGRSAYITNLS
*YTLTQTFVTHSHTASVRSVAATSKLAASSGADETVVLYDMVKRKQSGALMQHEGTITCLKFTPEGSHLISCSDDGSIAIFRVGSWQLEKLFKKAHKGTAVNHISIHPSGKLALSVGKDKTLRTWNLVKGRSAYITNL*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KYTLTQTFVTHSHTASVRSVAATSKLAASSGADETVVLYDMVKRKQSGALMQHEGTITCLKFTPEGSHLISCSDDGSIAIFRVGSWQLEKLFKKAHKGTAVNHISIHPSGKLALSVGKDKTLRTWNLVKGRSAYITNLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query139 2.2.26 [Sep-21-2011]
Q5ZKU8 369 p21-activated protein kin yes N/A 0.964 0.363 0.547 5e-34
Q9NWT1 392 p21-activated protein kin yes N/A 0.971 0.344 0.543 1e-33
Q68FJ6 363 p21-activated protein kin N/A N/A 0.920 0.352 0.526 2e-33
Q6TNS2 368 p21-activated protein kin yes N/A 0.971 0.366 0.5 3e-33
Q9DCE5 382 p21-activated protein kin yes N/A 0.964 0.350 0.532 5e-33
Q5EA99 392 p21-activated protein kin yes N/A 0.971 0.344 0.514 5e-32
P20484 468 Protein MAK11 OS=Saccharo yes N/A 0.928 0.275 0.321 1e-16
O74453 341 Shk1 kinase-binding prote yes N/A 0.920 0.375 0.328 3e-13
Q5RD06 451 POC1 centriolar protein h no N/A 0.820 0.252 0.313 2e-11
Q8TC44 478 POC1 centriolar protein h no N/A 0.820 0.238 0.313 2e-11
>sp|Q5ZKU8|PK1IP_CHICK p21-activated protein kinase-interacting protein 1-like OS=Gallus gallus GN=PAK1IP1 PE=2 SV=1 Back     alignment and function desciption
 Score =  142 bits (359), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 75/137 (54%), Positives = 97/137 (70%), Gaps = 3/137 (2%)

Query: 2   YTLTQTFVTHSHTASVRSVAATSKLAASSGADETVVLYDMVKRKQSGALMQHEGTITCLK 61
           +T+T  F  H+HTAS+ +VA  SK   +   DE++ +YDM K+ + GAL+QH GTITCL+
Sbjct: 23  WTVTPDFTHHAHTASLSAVAVNSKYVVTGSRDESIQIYDMRKKVEHGALLQHNGTITCLE 82

Query: 62  FTPEGSHLISCSDDGSIAIFRVGSWQLEKLFKKAHKGTAVNHISIHPSGKLALSVGKDKT 121
           F    +HL+S ++DG I I+    W+  K   KAHKG  V  +SIHPSGKLALSVG DKT
Sbjct: 83  FYGT-AHLLSGAEDGLICIWNTKRWECLKSI-KAHKG-HVTSLSIHPSGKLALSVGTDKT 139

Query: 122 LRTWNLVKGRSAYITNL 138
           LRTWNLV+GRSA+I NL
Sbjct: 140 LRTWNLVEGRSAFIKNL 156




Negatively regulates the PAK1 kinase.
Gallus gallus (taxid: 9031)
>sp|Q9NWT1|PK1IP_HUMAN p21-activated protein kinase-interacting protein 1 OS=Homo sapiens GN=PAK1IP1 PE=1 SV=2 Back     alignment and function description
>sp|Q68FJ6|PK1IP_XENLA p21-activated protein kinase-interacting protein 1-like OS=Xenopus laevis GN=pak1ip1 PE=2 SV=1 Back     alignment and function description
>sp|Q6TNS2|PK1IP_DANRE p21-activated protein kinase-interacting protein 1-like OS=Danio rerio GN=pak1ip1 PE=2 SV=1 Back     alignment and function description
>sp|Q9DCE5|PK1IP_MOUSE p21-activated protein kinase-interacting protein 1 OS=Mus musculus GN=Pak1ip1 PE=2 SV=2 Back     alignment and function description
>sp|Q5EA99|PK1IP_BOVIN p21-activated protein kinase-interacting protein 1 OS=Bos taurus GN=PAK1IP1 PE=2 SV=1 Back     alignment and function description
>sp|P20484|MAK11_YEAST Protein MAK11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAK11 PE=1 SV=1 Back     alignment and function description
>sp|O74453|SKB15_SCHPO Shk1 kinase-binding protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skb15 PE=4 SV=1 Back     alignment and function description
>sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 Back     alignment and function description
>sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
332031286 497 p21-activated protein kinase-interacting 0.992 0.277 0.608 4e-47
322794796 500 hypothetical protein SINV_07395 [Solenop 0.992 0.276 0.608 3e-46
307175895 498 p21-activated protein kinase-interacting 0.992 0.277 0.601 6e-44
193678963 373 PREDICTED: p21-activated protein kinase- 0.978 0.364 0.625 2e-43
383864157 479 PREDICTED: p21-activated protein kinase- 0.992 0.288 0.579 2e-43
350400307 306 PREDICTED: p21-activated protein kinase- 0.992 0.450 0.565 5e-43
307208694 517 p21-activated protein kinase-interacting 0.992 0.266 0.601 6e-43
380012738 375 PREDICTED: p21-activated protein kinase- 0.992 0.368 0.586 8e-43
328788130 487 PREDICTED: p21-activated protein kinase- 0.992 0.283 0.586 2e-42
340717907 306 PREDICTED: p21-activated protein kinase- 0.992 0.450 0.565 2e-42
>gi|332031286|gb|EGI70814.1| p21-activated protein kinase-interacting protein 1-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 84/138 (60%), Positives = 110/138 (79%)

Query: 1   KYTLTQTFVTHSHTASVRSVAATSKLAASSGADETVVLYDMVKRKQSGALMQHEGTITCL 60
           +Y + ++F THSH +S+R+VA++    AS+GADETV LYDM  R++SG LM H+ TI C+
Sbjct: 33  EYKIEKSFATHSHVSSIRAVASSKYYLASAGADETVCLYDMRYRRESGKLMHHKDTINCI 92

Query: 61  KFTPEGSHLISCSDDGSIAIFRVGSWQLEKLFKKAHKGTAVNHISIHPSGKLALSVGKDK 120
            FTPEGSHL +CS+DGSI + R G+WQLEK++  AHKG+AVN ++IHP+GKLALS G+D 
Sbjct: 93  AFTPEGSHLFACSNDGSITVVRCGNWQLEKVWSTAHKGSAVNTLAIHPTGKLALSTGEDG 152

Query: 121 TLRTWNLVKGRSAYITNL 138
            LRTWNL+KGR AY TNL
Sbjct: 153 VLRTWNLIKGRPAYATNL 170




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|322794796|gb|EFZ17743.1| hypothetical protein SINV_07395 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307175895|gb|EFN65710.1| p21-activated protein kinase-interacting protein 1-like [Camponotus floridanus] Back     alignment and taxonomy information
>gi|193678963|ref|XP_001952263.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|383864157|ref|XP_003707546.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like [Megachile rotundata] gi|383866436|ref|XP_003708676.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350400307|ref|XP_003485793.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307208694|gb|EFN85984.1| p21-activated protein kinase-interacting protein 1-like [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|380012738|ref|XP_003690434.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like, partial [Apis florea] Back     alignment and taxonomy information
>gi|328788130|ref|XP_395312.3| PREDICTED: p21-activated protein kinase-interacting protein 1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340717907|ref|XP_003397415.1| PREDICTED: p21-activated protein kinase-interacting protein 1-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
UNIPROTKB|F1NWB8 367 PAK1IP1 "p21-activated protein 0.964 0.365 0.547 9.5e-34
UNIPROTKB|Q5ZKU8 369 PAK1IP1 "p21-activated protein 0.964 0.363 0.547 9.5e-34
UNIPROTKB|Q9NWT1 392 PAK1IP1 "p21-activated protein 0.971 0.344 0.543 2e-33
ZFIN|ZDB-GENE-030131-8414 368 pak1ip1 "PAK1 interacting prot 0.971 0.366 0.5 3.2e-33
UNIPROTKB|E2RDQ1 394 PAK1IP1 "Uncharacterized prote 0.971 0.342 0.536 6.7e-33
MGI|MGI:1915333 382 Pak1ip1 "PAK1 interacting prot 0.964 0.350 0.532 8.5e-33
RGD|1565353 382 Pak1ip1 "PAK1 interacting prot 0.956 0.348 0.528 2.9e-32
UNIPROTKB|F1MRA9 392 PAK1IP1 "p21-activated protein 0.913 0.323 0.553 3.7e-32
UNIPROTKB|Q5EA99 392 PAK1IP1 "p21-activated protein 0.913 0.323 0.545 7.7e-32
TAIR|locus:2014988 345 AT1G65030 "AT1G65030" [Arabido 0.964 0.388 0.405 1.5e-19
UNIPROTKB|F1NWB8 PAK1IP1 "p21-activated protein kinase-interacting protein 1-like" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 367 (134.2 bits), Expect = 9.5e-34, P = 9.5e-34
 Identities = 75/137 (54%), Positives = 97/137 (70%)

Query:     2 YTLTQTFVTHSHTASVRSVAATSKLAASSGADETVVLYDMVKRKQSGALMQHEGTITCLK 61
             +T+T  F  H+HTAS+ +VA  SK   +   DE++ +YDM K+ + GAL+QH GTITCL+
Sbjct:    21 WTVTPDFTHHAHTASLSAVAVNSKYVVTGSRDESIQIYDMRKKVEHGALLQHNGTITCLE 80

Query:    62 FTPEGSHLISCSDDGSIAIFRVGSWQLEKLFKKAHKGTAVNHISIHPSGKLALSVGKDKT 121
             F    +HL+S ++DG I I+    W+  K  K AHKG  V  +SIHPSGKLALSVG DKT
Sbjct:    81 FYGT-AHLLSGAEDGLICIWNTKRWECLKSIK-AHKGH-VTSLSIHPSGKLALSVGTDKT 137

Query:   122 LRTWNLVKGRSAYITNL 138
             LRTWNLV+GRSA+I NL
Sbjct:   138 LRTWNLVEGRSAFIKNL 154




GO:0005634 "nucleus" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
UNIPROTKB|Q5ZKU8 PAK1IP1 "p21-activated protein kinase-interacting protein 1-like" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NWT1 PAK1IP1 "p21-activated protein kinase-interacting protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8414 pak1ip1 "PAK1 interacting protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RDQ1 PAK1IP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1915333 Pak1ip1 "PAK1 interacting protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1565353 Pak1ip1 "PAK1 interacting protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MRA9 PAK1IP1 "p21-activated protein kinase-interacting protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5EA99 PAK1IP1 "p21-activated protein kinase-interacting protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TAIR|locus:2014988 AT1G65030 "AT1G65030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9DCE5PK1IP_MOUSENo assigned EC number0.53280.96400.3507yesN/A
Q5ZKU8PK1IP_CHICKNo assigned EC number0.54740.96400.3631yesN/A
Q9NWT1PK1IP_HUMANNo assigned EC number0.54340.97120.3443yesN/A
Q5EA99PK1IP_BOVINNo assigned EC number0.51440.97120.3443yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-20
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 2e-18
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-18
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-14
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 9e-14
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 7e-12
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 1e-11
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-10
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-09
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-09
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 8e-07
smart0032040 smart00320, WD40, WD40 repeats 7e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-05
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 9e-04
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 0.003
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 0.004
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score = 82.8 bits (205), Expect = 4e-20
 Identities = 40/131 (30%), Positives = 61/131 (46%), Gaps = 4/131 (3%)

Query: 3   TLTQTFVTHSHTASVRSVAA--TSKLAASSGADETVVLYDMVKRKQSGALMQHEGTITCL 60
           T         HT  V SVA        ASS  D T+ L+D+   K    L  H G +  +
Sbjct: 124 TGKCLTTLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWDLRTGKCVATLTGHTGEVNSV 183

Query: 61  KFTPEGSHLISCSDDGSIAIFRVGSWQLEKLFKKAHKGTAVNHISIHPSGKLALSVGKDK 120
            F+P+G  L+S S DG+I ++ + + +      + H+   VN ++  P G L  S  +D 
Sbjct: 184 AFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTL-RGHEN-GVNSVAFSPDGYLLASGSEDG 241

Query: 121 TLRTWNLVKGR 131
           T+R W+L  G 
Sbjct: 242 TIRVWDLRTGE 252


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 139
KOG0271|consensus 480 99.95
KOG0286|consensus343 99.95
KOG0272|consensus459 99.95
KOG0279|consensus 315 99.94
KOG0263|consensus707 99.94
KOG0263|consensus707 99.94
PTZ00421 493 coronin; Provisional 99.94
KOG0272|consensus459 99.93
KOG0266|consensus 456 99.93
KOG0266|consensus456 99.93
KOG0294|consensus 362 99.92
KOG0279|consensus315 99.92
KOG0286|consensus343 99.92
PTZ00420 568 coronin; Provisional 99.92
KOG0271|consensus 480 99.92
KOG0285|consensus 460 99.92
KOG0273|consensus524 99.91
KOG0315|consensus311 99.9
KOG0291|consensus 893 99.9
KOG0276|consensus 794 99.9
KOG0316|consensus 307 99.9
KOG0295|consensus406 99.89
KOG0283|consensus 712 99.89
KOG0282|consensus 503 99.89
PTZ00421 493 coronin; Provisional 99.88
KOG0319|consensus 775 99.88
KOG0284|consensus 464 99.88
KOG0285|consensus 460 99.88
KOG0296|consensus 399 99.87
KOG0318|consensus 603 99.87
KOG0315|consensus 311 99.87
KOG0283|consensus 712 99.87
KOG0275|consensus 508 99.87
KOG0318|consensus 603 99.87
KOG0291|consensus 893 99.87
KOG0302|consensus440 99.86
KOG0281|consensus499 99.86
KOG0264|consensus422 99.86
KOG0316|consensus307 99.86
KOG0281|consensus499 99.86
KOG0269|consensus 839 99.86
KOG0289|consensus506 99.86
KOG0643|consensus 327 99.85
KOG0303|consensus 472 99.85
KOG0645|consensus312 99.85
KOG0284|consensus 464 99.85
KOG0277|consensus311 99.85
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 99.85
KOG0319|consensus 775 99.84
KOG0265|consensus 338 99.84
KOG0295|consensus406 99.84
KOG0647|consensus 347 99.84
PTZ00420 568 coronin; Provisional 99.84
KOG0296|consensus 399 99.84
KOG0265|consensus 338 99.84
KOG0292|consensus 1202 99.84
KOG0772|consensus 641 99.84
KOG0645|consensus 312 99.84
KOG0275|consensus 508 99.83
KOG0313|consensus423 99.83
KOG0310|consensus 487 99.83
KOG0293|consensus 519 99.83
KOG0640|consensus430 99.83
KOG0276|consensus 794 99.83
KOG0310|consensus 487 99.83
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 99.83
PLN00181 793 protein SPA1-RELATED; Provisional 99.82
KOG0273|consensus524 99.82
KOG0267|consensus 825 99.82
KOG0282|consensus 503 99.82
KOG0308|consensus 735 99.82
KOG0277|consensus 311 99.82
KOG0973|consensus 942 99.82
PLN00181 793 protein SPA1-RELATED; Provisional 99.81
KOG0292|consensus 1202 99.81
KOG0302|consensus440 99.81
KOG1407|consensus313 99.81
KOG0264|consensus422 99.8
KOG2110|consensus 391 99.8
KOG0640|consensus 430 99.8
KOG0643|consensus327 99.8
KOG1446|consensus311 99.8
KOG0274|consensus 537 99.8
KOG0289|consensus506 99.8
KOG1034|consensus 385 99.79
KOG1273|consensus 405 99.79
KOG0305|consensus484 99.79
KOG0306|consensus 888 99.78
KOG0274|consensus 537 99.78
KOG1274|consensus 933 99.78
KOG0306|consensus 888 99.78
KOG1445|consensus 1012 99.78
KOG0646|consensus 476 99.78
KOG0278|consensus334 99.78
KOG0639|consensus 705 99.77
KOG0772|consensus 641 99.77
KOG1446|consensus 311 99.76
KOG0300|consensus481 99.76
KOG2111|consensus346 99.76
KOG1407|consensus313 99.76
KOG0270|consensus463 99.75
KOG0313|consensus423 99.75
KOG4283|consensus 397 99.75
KOG0305|consensus 484 99.74
KOG1332|consensus 299 99.74
KOG0647|consensus 347 99.74
KOG1539|consensus 910 99.73
KOG2048|consensus 691 99.73
KOG0646|consensus 476 99.73
KOG0641|consensus350 99.73
KOG0269|consensus 839 99.73
KOG2394|consensus 636 99.73
KOG0308|consensus 735 99.72
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.72
KOG0293|consensus 519 99.72
KOG0288|consensus459 99.72
KOG0278|consensus 334 99.72
KOG1332|consensus299 99.71
KOG1539|consensus 910 99.71
KOG1009|consensus 434 99.71
KOG4283|consensus 397 99.71
KOG0267|consensus 825 99.71
KOG0300|consensus 481 99.7
KOG1063|consensus 764 99.7
KOG0299|consensus 479 99.7
KOG0303|consensus 472 99.7
KOG0973|consensus 942 99.69
KOG0288|consensus459 99.69
KOG1036|consensus 323 99.69
KOG2445|consensus 361 99.68
KOG0649|consensus325 99.68
KOG2096|consensus420 99.68
KOG0301|consensus 745 99.68
KOG0299|consensus 479 99.68
KOG0294|consensus 362 99.66
KOG2394|consensus 636 99.66
KOG0301|consensus 745 99.66
KOG0268|consensus433 99.66
KOG2110|consensus 391 99.65
KOG1274|consensus 933 99.65
KOG1036|consensus 323 99.65
KOG0268|consensus 433 99.64
KOG0322|consensus323 99.64
KOG0649|consensus 325 99.64
KOG0771|consensus398 99.63
KOG1273|consensus 405 99.63
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.63
KOG3881|consensus412 99.63
KOG1310|consensus 758 99.62
KOG2096|consensus 420 99.62
KOG0290|consensus364 99.62
KOG0639|consensus705 99.62
KOG0642|consensus 577 99.61
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.61
KOG1009|consensus 434 99.61
KOG0321|consensus 720 99.61
KOG1408|consensus 1080 99.61
KOG1445|consensus 1012 99.6
KOG0270|consensus 463 99.59
KOG0641|consensus350 99.59
KOG1007|consensus 370 99.59
KOG0644|consensus 1113 99.58
KOG1188|consensus 376 99.58
KOG2919|consensus406 99.57
KOG4227|consensus 609 99.56
KOG1408|consensus 1080 99.55
KOG0642|consensus577 99.54
KOG4328|consensus498 99.54
KOG1523|consensus 361 99.54
KOG2048|consensus 691 99.53
KOG2106|consensus 626 99.53
KOG2055|consensus514 99.53
KOG0307|consensus 1049 99.52
KOG4378|consensus 673 99.52
KOG4378|consensus 673 99.52
KOG2106|consensus626 99.51
KOG1007|consensus370 99.5
KOG1523|consensus 361 99.49
KOG1034|consensus385 99.49
KOG1188|consensus 376 99.48
KOG1063|consensus764 99.47
KOG0974|consensus 967 99.46
KOG1272|consensus 545 99.46
KOG2445|consensus361 99.46
KOG0321|consensus 720 99.45
KOG3914|consensus 390 99.45
KOG1272|consensus 545 99.44
KOG1963|consensus 792 99.44
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.44
KOG0307|consensus 1049 99.44
COG2319 466 FOG: WD40 repeat [General function prediction only 99.43
KOG0322|consensus323 99.43
KOG2055|consensus 514 99.43
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.42
KOG1240|consensus 1431 99.42
KOG1538|consensus 1081 99.41
KOG4328|consensus498 99.4
KOG1587|consensus555 99.4
KOG0650|consensus 733 99.39
KOG2111|consensus346 99.37
KOG2139|consensus 445 99.36
KOG2321|consensus 703 99.34
KOG1524|consensus 737 99.33
COG2319 466 FOG: WD40 repeat [General function prediction only 99.31
KOG2919|consensus 406 99.31
KOG2695|consensus425 99.31
KOG0650|consensus733 99.31
KOG2139|consensus 445 99.29
KOG1310|consensus 758 99.29
KOG0974|consensus 967 99.27
KOG0771|consensus398 99.27
KOG1524|consensus 737 99.26
KOG0280|consensus339 99.25
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.25
KOG2321|consensus 703 99.24
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.24
KOG4227|consensus 609 99.23
PRK11028 330 6-phosphogluconolactonase; Provisional 99.2
KOG1517|consensus1387 99.2
KOG4547|consensus 541 99.2
PRK11028 330 6-phosphogluconolactonase; Provisional 99.18
KOG0280|consensus339 99.17
KOG4547|consensus 541 99.15
KOG0290|consensus 364 99.15
KOG1538|consensus 1081 99.14
PRK05137 435 tolB translocation protein TolB; Provisional 99.13
KOG3881|consensus 412 99.11
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 99.09
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.08
PRK01742429 tolB translocation protein TolB; Provisional 99.07
PRK03629429 tolB translocation protein TolB; Provisional 99.07
COG4946 668 Uncharacterized protein related to the periplasmic 99.06
KOG1587|consensus555 99.06
KOG2041|consensus 1189 99.05
KOG1409|consensus404 99.04
KOG1517|consensus1387 99.03
KOG1963|consensus 792 99.02
PRK01742 429 tolB translocation protein TolB; Provisional 99.01
KOG4190|consensus 1034 98.99
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.98
PRK04922433 tolB translocation protein TolB; Provisional 98.98
KOG2315|consensus 566 98.97
PRK04922433 tolB translocation protein TolB; Provisional 98.93
PRK02889427 tolB translocation protein TolB; Provisional 98.93
PRK05137 435 tolB translocation protein TolB; Provisional 98.93
PRK03629429 tolB translocation protein TolB; Provisional 98.93
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.92
KOG1064|consensus2439 98.91
KOG1064|consensus2439 98.9
PRK02889427 tolB translocation protein TolB; Provisional 98.9
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.9
KOG4497|consensus 447 98.9
KOG1240|consensus 1431 98.89
KOG1409|consensus 404 98.89
PRK00178430 tolB translocation protein TolB; Provisional 98.89
KOG1334|consensus 559 98.87
KOG2066|consensus 846 98.85
PF10282 345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.83
PRK01029428 tolB translocation protein TolB; Provisional 98.81
COG2706 346 3-carboxymuconate cyclase [Carbohydrate transport 98.8
KOG4714|consensus319 98.8
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.79
KOG4532|consensus344 98.78
PRK04792448 tolB translocation protein TolB; Provisional 98.77
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.76
KOG4714|consensus319 98.75
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.75
PRK01029428 tolB translocation protein TolB; Provisional 98.71
KOG4497|consensus 447 98.7
KOG0309|consensus 1081 98.69
KOG3914|consensus 390 98.67
KOG4532|consensus344 98.67
KOG0644|consensus 1113 98.66
KOG4640|consensus 665 98.66
PRK00178 430 tolB translocation protein TolB; Provisional 98.65
KOG1354|consensus 433 98.64
KOG1275|consensus 1118 98.63
KOG4190|consensus 1034 98.61
KOG1912|consensus 1062 98.6
COG4946 668 Uncharacterized protein related to the periplasmic 98.59
KOG3621|consensus 726 98.58
PRK04792448 tolB translocation protein TolB; Provisional 98.57
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.55
KOG4640|consensus 665 98.55
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.53
KOG1832|consensus 1516 98.53
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.5
KOG1354|consensus 433 98.49
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 98.48
PF10282 345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.47
KOG1645|consensus 463 98.45
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.44
PRK04043419 tolB translocation protein TolB; Provisional 98.4
KOG3617|consensus 1416 98.38
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.38
KOG2315|consensus 566 98.36
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.32
KOG2695|consensus425 98.28
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.27
PRK04043419 tolB translocation protein TolB; Provisional 98.26
KOG2314|consensus 698 98.26
KOG1334|consensus559 98.21
KOG1275|consensus 1118 98.17
KOG2066|consensus 846 98.17
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.17
PRK02888 635 nitrous-oxide reductase; Validated 98.17
KOG2314|consensus 698 98.16
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 98.16
KOG4649|consensus 354 98.14
KOG2079|consensus 1206 98.1
KOG1912|consensus 1062 98.08
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 98.07
KOG0882|consensus 558 98.05
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.05
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.03
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.01
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 98.01
PRK11138 394 outer membrane biogenesis protein BamB; Provisiona 98.01
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.99
PF07433 305 DUF1513: Protein of unknown function (DUF1513); In 97.99
KOG2114|consensus 933 97.98
KOG2041|consensus 1189 97.97
KOG0309|consensus 1081 97.94
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 97.93
COG2706 346 3-carboxymuconate cyclase [Carbohydrate transport 97.88
KOG1645|consensus 463 97.86
KOG2444|consensus238 97.86
PF07433 305 DUF1513: Protein of unknown function (DUF1513); In 97.86
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.84
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 97.84
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.82
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.81
KOG1920|consensus 1265 97.8
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.78
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.76
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.7
PRK02888 635 nitrous-oxide reductase; Validated 97.69
KOG0882|consensus 558 97.66
KOG1008|consensus 783 97.58
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.55
KOG4649|consensus 354 97.51
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.46
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 97.42
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.41
KOG2079|consensus 1206 97.39
KOG2114|consensus 933 97.39
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 97.37
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.35
KOG1832|consensus 1516 97.34
KOG3621|consensus 726 97.32
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.3
PF06433 342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.29
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.28
KOG1008|consensus 783 97.24
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.21
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.18
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.15
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.1
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.08
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.08
PRK13616 591 lipoprotein LpqB; Provisional 96.93
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 96.91
PF02897 414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.88
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 96.88
PF06977 248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.87
COG3391 381 Uncharacterized conserved protein [Function unknow 96.84
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.82
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.81
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.78
KOG2395|consensus 644 96.76
KOG3617|consensus 1416 96.74
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.68
PF00780 275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.62
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 96.62
COG3490366 Uncharacterized protein conserved in bacteria [Fun 96.61
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 96.56
KOG1920|consensus 1265 96.54
COG3204 316 Uncharacterized protein conserved in bacteria [Fun 96.54
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.42
PRK13616591 lipoprotein LpqB; Provisional 96.4
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.38
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 96.32
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.23
COG3391 381 Uncharacterized conserved protein [Function unknow 96.21
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.18
PF14583 386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 95.96
KOG2444|consensus238 95.96
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 95.83
COG1520 370 FOG: WD40-like repeat [Function unknown] 95.8
PHA02713557 hypothetical protein; Provisional 95.77
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 95.72
PF07569 219 Hira: TUP1-like enhancer of split; InterPro: IPR01 95.4
PF02897 414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 95.35
KOG2395|consensus644 95.31
KOG4441|consensus571 95.24
KOG3630|consensus 1405 95.22
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 95.19
COG3490 366 Uncharacterized protein conserved in bacteria [Fun 95.18
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 95.13
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 95.01
COG3386 307 Gluconolactonase [Carbohydrate transport and metab 95.01
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.01
PHA02713557 hypothetical protein; Provisional 94.89
KOG4460|consensus 741 94.88
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 94.86
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 94.8
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 94.78
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 94.77
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 94.75
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 94.7
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 94.69
KOG4441|consensus 571 94.68
PF0101138 PQQ: PQQ enzyme repeat family.; InterPro: IPR00237 94.66
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 94.56
PF05694 461 SBP56: 56kDa selenium binding protein (SBP56); Int 94.26
PHA03098534 kelch-like protein; Provisional 94.22
KOG3630|consensus 1405 94.13
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 94.09
KOG1916|consensus 1283 94.0
PHA02790480 Kelch-like protein; Provisional 93.11
KOG4499|consensus310 93.06
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 92.82
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 92.79
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 92.32
PHA03098 534 kelch-like protein; Provisional 92.2
COG5167776 VID27 Protein involved in vacuole import and degra 92.14
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 92.0
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 91.91
KOG4499|consensus310 91.75
KOG2377|consensus 657 91.74
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 91.71
PF14761 215 HPS3_N: Hermansky-Pudlak syndrome 3 91.29
KOG1898|consensus 1205 91.23
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 90.97
TIGR02171 912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 90.9
KOG1896|consensus 1366 90.85
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 90.8
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 90.79
PRK10115 686 protease 2; Provisional 90.62
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 90.62
COG5167 776 VID27 Protein involved in vacuole import and degra 90.51
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 90.49
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 90.37
PHA02790480 Kelch-like protein; Provisional 90.28
COG3823262 Glutamine cyclotransferase [Posttranslational modi 90.05
PRK10115 686 protease 2; Provisional 90.01
PF1357040 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A. 89.71
KOG1897|consensus 1096 89.43
COG1520 370 FOG: WD40-like repeat [Function unknown] 89.41
PF0101138 PQQ: PQQ enzyme repeat family.; InterPro: IPR00237 89.39
PF14583 386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 89.22
PF05935 477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 89.04
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 88.87
KOG2280|consensus 829 88.46
KOG2109|consensus 788 88.36
PF14727 418 PHTB1_N: PTHB1 N-terminus 87.96
PF1234127 DUF3639: Protein of unknown function (DUF3639) ; I 87.95
KOG1897|consensus 1096 87.17
COG3823262 Glutamine cyclotransferase [Posttranslational modi 86.72
PF12768 281 Rax2: Cortical protein marker for cell polarity 86.07
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 85.83
COG4590 733 ABC-type uncharacterized transport system, permeas 85.76
PF05935 477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 85.6
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 85.54
TIGR03118 336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 85.5
PF12768 281 Rax2: Cortical protein marker for cell polarity 84.87
COG3204316 Uncharacterized protein conserved in bacteria [Fun 84.67
KOG3616|consensus 1636 84.66
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 84.12
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 83.63
KOG2103|consensus 910 83.46
KOG2247|consensus 615 83.44
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 83.34
COG5276 370 Uncharacterized conserved protein [Function unknow 82.78
KOG2377|consensus 657 82.25
KOG2727|consensus 1244 81.88
PF05787524 DUF839: Bacterial protein of unknown function (DUF 81.75
TIGR03054135 photo_alph_chp1 putative photosynthetic complex as 80.27
>KOG0271|consensus Back     alignment and domain information
Probab=99.95  E-value=1.1e-27  Score=153.39  Aligned_cols=126  Identities=24%  Similarity=0.331  Sum_probs=114.4

Q ss_pred             eecceeeEEEEec--CCcEEEEeCCCCeEEEEEccCCceeeEEEecCCCeEEEEECCCCCEEEEecCCCcEEEEEeCCce
Q psy11518         10 THSHTASVRSVAA--TSKLAASSGADETVVLYDMVKRKQSGALMQHEGTITCLKFTPEGSHLISCSDDGSIAIFRVGSWQ   87 (139)
Q Consensus        10 ~~~~~~~v~~~~~--~~~~l~~~~~~~~v~i~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~~i~~~d~~~~~   87 (139)
                      ..||..+|.|+.|  ++..|++|+.|.++++||+.+..+..+.++|...|.|++|+|||+.+|+|+.||.|++||..+++
T Consensus       111 ~~GH~e~Vl~~~fsp~g~~l~tGsGD~TvR~WD~~TeTp~~t~KgH~~WVlcvawsPDgk~iASG~~dg~I~lwdpktg~  190 (480)
T KOG0271|consen  111 IAGHGEAVLSVQFSPTGSRLVTGSGDTTVRLWDLDTETPLFTCKGHKNWVLCVAWSPDGKKIASGSKDGSIRLWDPKTGQ  190 (480)
T ss_pred             cCCCCCcEEEEEecCCCceEEecCCCceEEeeccCCCCcceeecCCccEEEEEEECCCcchhhccccCCeEEEecCCCCC
Confidence            4578899999887  89999999999999999999999999999999999999999999999999999999999999988


Q ss_pred             EEEEEEeCCCCcceeEEEEcc-----CCcEEEEEcCCCeEEEEEcCCCceeEEE
Q psy11518         88 LEKLFKKAHKGTAVNHISIHP-----SGKLALSVGKDKTLRTWNLVKGRSAYIT  136 (139)
Q Consensus        88 ~~~~~~~~~~~~~v~~~~~~~-----~~~~l~~~~~d~~i~i~d~~~~~~~~~~  136 (139)
                      .+..--..|... |++++|.|     ..+++++++.||.++|||+..++.+..+
T Consensus       191 ~~g~~l~gH~K~-It~Lawep~hl~p~~r~las~skDg~vrIWd~~~~~~~~~l  243 (480)
T KOG0271|consen  191 QIGRALRGHKKW-ITALAWEPLHLVPPCRRLASSSKDGSVRIWDTKLGTCVRTL  243 (480)
T ss_pred             cccccccCcccc-eeEEeecccccCCCccceecccCCCCEEEEEccCceEEEEe
Confidence            776554667766 99999997     6679999999999999999988877654



>KOG0286|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF01011 PQQ: PQQ enzyme repeat family Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>KOG1898|consensus Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>KOG1896|consensus Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF13570 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PF01011 PQQ: PQQ enzyme repeat family Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>KOG2109|consensus Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF12341 DUF3639: Protein of unknown function (DUF3639) ; InterPro: IPR022100 This domain family is found in eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>KOG2103|consensus Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>KOG2727|consensus Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>TIGR03054 photo_alph_chp1 putative photosynthetic complex assembly protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
2ymu_A 577 Structure Of A Highly Repetitive Propeller Structur 1e-07
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 2e-07
2h9l_A329 Wdr5delta23 Length = 329 2e-07
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 2e-07
2g9a_A311 Structural Basis For The Specific Recognition Of Me 2e-07
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 2e-07
2g99_A308 Structural Basis For The Specific Recognition Of Me 2e-07
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 2e-07
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 2e-07
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 2e-07
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 2e-07
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 2e-07
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 2e-07
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 3e-07
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 3e-07
2gnq_A336 Structure Of Wdr5 Length = 336 3e-07
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 7e-07
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 7e-07
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 9e-07
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 1e-06
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 1e-06
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 2e-06
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 2e-06
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 3e-06
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 4e-06
1nr0_A 611 Two Seven-Bladed Beta-Propeller Domains Revealed By 7e-06
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 1e-05
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 4e-05
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 5e-05
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 5e-05
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 5e-05
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 5e-05
2hes_X 330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 7e-05
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 2e-04
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 2e-04
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 2e-04
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 2e-04
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 2e-04
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 3e-04
1p22_A 435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 3e-04
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 3e-04
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 3e-04
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 3e-04
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 4e-04
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 4e-04
3zey_7 318 High-resolution Cryo-electron Microscopy Structure 4e-04
1erj_A 393 Crystal Structure Of The C-Terminal Wd40 Domain Of 4e-04
1r5m_A425 Crystal Structure Of The C-Terminal Wd40 Domain Of 4e-04
1gxr_A 337 Wd40 Region Of Human Groucho/tle1 Length = 337 6e-04
3vl1_A 420 Crystal Structure Of Yeast Rpn14 Length = 420 7e-04
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure

Iteration: 1

Score = 51.6 bits (122), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 34/127 (26%), Positives = 64/127 (50%), Gaps = 12/127 (9%) Query: 4 LTQTFVTHSHTASVRSVAATSKLAASSGADETVVLYDMVKRKQSGALMQ----HEGTITC 59 L QT HS + + + + AS+ D+TV L++ ++G L+Q H ++ Sbjct: 172 LLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWN-----RNGQLLQTLTGHSSSVRG 226 Query: 60 LKFTPEGSHLISCSDDGSIAIFRVGSWQLEKLFKKAHKGTAVNHISIHPSGKLALSVGKD 119 + F+P+G + S SDD ++ ++ L+ L + ++VN ++ P G+ S D Sbjct: 227 VAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHS---SSVNGVAFRPDGQTIASASDD 283 Query: 120 KTLRTWN 126 KT++ WN Sbjct: 284 KTVKLWN 290
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|1NR0|A Chain A, Two Seven-Bladed Beta-Propeller Domains Revealed By The Structure Of A C. Elegans Homologue Of Yeast Actin Interacting Protein 1 (Aip1). Length = 611 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|1R5M|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Sif2 Length = 425 Back     alignment and structure
>pdb|1GXR|A Chain A, Wd40 Region Of Human Groucho/tle1 Length = 337 Back     alignment and structure
>pdb|3VL1|A Chain A, Crystal Structure Of Yeast Rpn14 Length = 420 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.96
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.95
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.95
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 99.95
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.95
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.95
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.95
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.94
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 99.94
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.94
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.94
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.94
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.94
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.94
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 99.94
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.94
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 99.94
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.93
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.93
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.93
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.93
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.93
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.93
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.93
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.93
2pm7_B 297 Protein transport protein SEC13, protein transport 99.93
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 99.92
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 99.92
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.92
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.92
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.92
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.92
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 99.92
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 99.92
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.92
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 99.92
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.92
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.92
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 99.92
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.92
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.91
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.91
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.91
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.91
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 99.91
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.91
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 99.91
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.91
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.91
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.91
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.91
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.91
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.9
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 99.9
2pm7_B297 Protein transport protein SEC13, protein transport 99.9
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.9
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.9
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.9
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.9
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 99.9
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 99.9
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.9
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 99.9
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 99.9
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.9
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.9
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.9
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.9
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.89
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.89
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.89
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 99.89
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.89
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.89
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.89
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.89
3jro_A 753 Fusion protein of protein transport protein SEC13 99.89
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.89
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.89
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.89
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.89
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.89
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.88
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.88
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.88
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.88
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 99.88
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.88
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.88
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.87
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.87
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.87
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.87
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.87
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.87
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.87
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.87
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.87
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.87
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.87
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.87
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.87
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 99.86
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.86
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.86
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.86
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.86
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 99.86
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.86
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.86
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.86
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.86
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.86
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 99.86
3jro_A 753 Fusion protein of protein transport protein SEC13 99.85
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 99.85
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.85
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 99.85
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.85
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 99.84
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.83
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.81
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.81
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.8
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.79
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.79
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.77
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.77
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.71
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.71
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.66
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.63
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.63
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.63
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.61
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.6
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 99.6
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.57
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.57
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 99.56
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.56
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.54
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.54
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.54
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.54
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.54
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.54
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.52
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.52
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.52
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.52
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.51
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.51
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.5
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.48
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.46
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.46
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.45
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.42
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.42
3no2_A 276 Uncharacterized protein; six-bladed beta-propeller 99.41
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.4
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.4
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.39
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.37
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.36
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.36
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 99.36
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.35
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.3
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.29
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.26
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.26
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 99.26
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.26
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.24
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.24
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.23
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.2
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.18
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 99.16
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.14
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.12
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 99.12
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 99.1
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 99.1
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 99.09
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.08
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.08
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 99.07
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.05
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.03
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.03
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.98
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.97
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 98.92
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 98.92
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.91
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 98.89
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 98.88
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.88
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.87
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.86
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.86
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.84
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.83
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.82
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.82
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 98.82
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 98.8
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.8
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.8
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.8
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.77
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.76
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 98.75
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.74
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 98.73
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 98.73
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.7
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.67
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.67
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.67
2qe8_A 343 Uncharacterized protein; structural genomics, join 98.63
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.63
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.56
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.55
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.54
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 98.53
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 98.52
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.52
2ece_A 462 462AA long hypothetical selenium-binding protein; 98.51
2ece_A 462 462AA long hypothetical selenium-binding protein; 98.49
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.47
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.46
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.44
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.39
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.37
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.35
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.34
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.34
3g4e_A 297 Regucalcin; six bladed beta-propeller, gluconolcat 98.33
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.32
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.26
2qe8_A 343 Uncharacterized protein; structural genomics, join 98.25
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.23
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.21
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.16
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.09
3hxj_A 330 Pyrrolo-quinoline quinone; all beta protein. incom 98.04
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.01
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 97.98
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.95
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.88
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.82
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 97.81
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.8
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.74
2p4o_A 306 Hypothetical protein; putative lactonase, structur 97.68
2be1_A 339 Serine/threonine-protein kinase/endoribonuclease; 97.61
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.57
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.54
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.46
3qqz_A 255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.41
1npe_A 267 Nidogen, entactin; glycoprotein, basement membrane 97.28
2p4o_A 306 Hypothetical protein; putative lactonase, structur 97.25
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.24
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.2
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.2
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.17
4hw6_A 433 Hypothetical protein, IPT/TIG domain protein; puta 97.17
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.16
3amr_A 355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.13
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 97.12
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.91
3v65_B386 Low-density lipoprotein receptor-related protein; 96.81
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.78
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 96.71
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 96.67
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 96.66
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 96.63
3v65_B386 Low-density lipoprotein receptor-related protein; 96.58
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 96.5
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 96.33
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 96.3
3kya_A 496 Putative phosphatase; structural genomics, joint c 96.26
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.22
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.15
4a2l_A 795 BT_4663, two-component system sensor histidine kin 96.07
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 96.03
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 95.77
3p5b_L400 Low density lipoprotein receptor variant; B-propel 95.61
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 95.6
3kya_A 496 Putative phosphatase; structural genomics, joint c 95.6
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 95.51
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 95.4
4a2l_A 795 BT_4663, two-component system sensor histidine kin 95.37
3v9f_A 781 Two-component system sensor histidine kinase/RESP 95.03
3v9f_A 781 Two-component system sensor histidine kinase/RESP 94.93
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 94.79
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 94.78
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 94.65
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 94.64
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 94.64
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 94.58
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 94.56
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 94.45
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 94.37
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 94.37
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 94.32
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 93.83
2be1_A 339 Serine/threonine-protein kinase/endoribonuclease; 93.8
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 93.78
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 93.61
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 93.56
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 93.55
2xzh_A 365 Clathrin heavy chain 1; endocytosis, endocytosis i 93.42
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 93.41
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 93.3
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 93.27
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 93.18
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 93.16
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 93.01
1tl2_A 236 L10, protein (tachylectin-2); animal lectin, horse 92.97
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 92.58
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 92.49
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 92.32
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 92.18
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 92.08
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 91.95
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 91.76
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 91.59
3f7f_A 729 Nucleoporin NUP120; nuclear pore complex, macromol 91.49
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 91.25
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 90.93
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 90.93
3f7f_A 729 Nucleoporin NUP120; nuclear pore complex, macromol 90.85
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 90.34
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 90.29
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 89.98
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 89.83
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 88.0
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 87.8
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 87.52
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 87.32
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 86.47
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 86.38
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 86.14
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 85.91
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 85.49
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 83.87
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 82.59
3al9_A539 Plexin-A2; beta-propeller, membrane protein, signa 80.3
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
Probab=99.96  E-value=6.5e-27  Score=151.00  Aligned_cols=129  Identities=22%  Similarity=0.316  Sum_probs=114.5

Q ss_pred             CeeeEEEEEeecceeeEEEEec--CCcEEEEeCCCCeEEEEEccCCceeeEEEecCCCeEEEEECCCCCEEEEecCCCcE
Q psy11518          1 KYTLTQTFVTHSHTASVRSVAA--TSKLAASSGADETVVLYDMVKRKQSGALMQHEGTITCLKFTPEGSHLISCSDDGSI   78 (139)
Q Consensus         1 ~~~~~~~~~~~~~~~~v~~~~~--~~~~l~~~~~~~~v~i~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~~i   78 (139)
                      |+++.+++.  +|...|.++.|  +++++++++.|+.|++||+.+++.+..+..|...|.+++|+|+++++++++.|+.|
T Consensus         2 ~l~~~~~~~--~h~~~V~~~~fsp~~~~l~s~~~dg~v~lWd~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~s~d~~i   79 (304)
T 2ynn_A            2 KLDIKKTFS--NRSDRVKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRI   79 (304)
T ss_dssp             CCCCEEEEE--EECSCEEEEEECSSSSEEEEEETTSEEEEEETTTTEEEEEEECCSSCEEEEEEEGGGTEEEEEETTSEE
T ss_pred             cceeEEeec--CCCCceEEEEECCCCCEEEEEcCCCcEEEEECCCCceeEEeeccCCcEEEEEEeCCCCEEEEECCCCEE
Confidence            456677776  56666666665  99999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEeCCceEEEEEEeCCCCcceeEEEEccCCcEEEEEcCCCeEEEEEcCCCcee
Q psy11518         79 AIFRVGSWQLEKLFKKAHKGTAVNHISIHPSGKLALSVGKDKTLRTWNLVKGRSA  133 (139)
Q Consensus        79 ~~~d~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~~i~i~d~~~~~~~  133 (139)
                      ++||+.+++....+ ..|... |.+++|+|+++++++++.|+.|++||++++..+
T Consensus        80 ~vwd~~~~~~~~~~-~~h~~~-v~~~~~~~~~~~l~sgs~D~~v~lWd~~~~~~~  132 (304)
T 2ynn_A           80 RVFNYNTGEKVVDF-EAHPDY-IRSIAVHPTKPYVLSGSDDLTVKLWNWENNWAL  132 (304)
T ss_dssp             EEEETTTCCEEEEE-ECCSSC-EEEEEECSSSSEEEEEETTSCEEEEEGGGTTEE
T ss_pred             EEEECCCCcEEEEE-eCCCCc-EEEEEEcCCCCEEEEECCCCeEEEEECCCCcch
Confidence            99999999988887 566665 999999999999999999999999999887443



>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3f7f_A Nucleoporin NUP120; nuclear pore complex, macromolecular assembly, membrane coat, nucleocytoplasmic transport, beta-propeller; 2.60A {Saccharomyces cerevisiae} PDB: 3h7n_A 3hxr_A Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3f7f_A Nucleoporin NUP120; nuclear pore complex, macromolecular assembly, membrane coat, nucleocytoplasmic transport, beta-propeller; 2.60A {Saccharomyces cerevisiae} PDB: 3h7n_A 3hxr_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3al9_A Plexin-A2; beta-propeller, membrane protein, signaling protein; HET: NAG; 2.10A {Mus musculus} PDB: 3al8_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 139
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-16
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-16
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-11
d1tbga_ 340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 4e-06
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-16
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 6e-11
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-09
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 8e-07
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 8e-06
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-05
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 6e-04
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-13
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 9e-11
d1erja_ 388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 4e-13
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 4e-09
d1gxra_ 337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-07
d1gxra_ 337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.003
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 5e-12
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-09
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-04
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.001
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-11
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 9e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-10
d1nr0a1 311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-07
d1nr0a1 311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 7e-07
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-05
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-09
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 5e-07
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-04
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 8e-04
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-08
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-08
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-06
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.002
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-08
d1pgua2 287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 6e-04
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 4e-08
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 4e-07
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-06
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 5e-05
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 8e-05
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-04
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 7e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 6e-08
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-07
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 2e-07
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-06
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-06
d1pgua1 325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 4e-05
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-04
d1pgua1 325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 0.002
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-05
d1p22a2 293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-05
d1p22a2 293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 6e-04
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-04
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.003
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 5e-04
d1ri6a_ 333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 0.001
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 72.8 bits (177), Expect = 1e-16
 Identities = 19/118 (16%), Positives = 40/118 (33%), Gaps = 6/118 (5%)

Query: 13  HTASVRSVA--ATSKLAASSGADETVVL--YDMVKRKQSGALMQHEGTITCLKFTPEGSH 68
           H + + ++         A+   D T  L      +   + +       IT + F+  G  
Sbjct: 225 HESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRL 284

Query: 69  LISCSDDGSIAIFRVGSWQLEKLFKKAHKGTAVNHISIHPSGKLALSVGKDKTLRTWN 126
           L++  DD +  ++         +    H    V+ + +   G    +   D  L+ WN
Sbjct: 285 LLAGYDDFNCNVWDALKADRAGVL-AGHDN-RVSCLGVTDDGMAVATGSWDSFLKIWN 340


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.94
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.93
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.93
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.92
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.92
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.92
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.9
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.9
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.9
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.9
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 99.89
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.89
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.89
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.89
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.88
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.87
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.87
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.87
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.86
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.85
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.84
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.84
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.82
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.82
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.82
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.77
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.77
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.77
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.76
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.74
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.72
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.66
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.64
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 99.63
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.61
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 99.59
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.58
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.54
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 99.52
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.49
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.47
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.38
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.37
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.25
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.18
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 99.16
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.15
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.14
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.94
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.89
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.82
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 98.76
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.69
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.51
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.31
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.24
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.22
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 98.13
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.08
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.05
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.03
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.02
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 97.94
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.87
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.79
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.78
d2hqsa1 269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.74
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.7
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.66
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.58
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 97.43
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 97.42
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.36
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.29
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.24
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 97.22
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.89
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 96.86
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.8
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.75
d2ghsa1 295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.57
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 96.42
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 96.33
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 96.22
d1qfma1 430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 95.45
d1utca2 327 Clathrin heavy-chain terminal domain {Rat (Rattus 95.01
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 94.96
d1qfma1 430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 94.01
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 93.14
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 92.68
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 90.86
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 90.12
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 89.96
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 89.67
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 89.66
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 89.65
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 88.76
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Antiviral protein Ski8 (Ski8p)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.94  E-value=2.9e-25  Score=145.96  Aligned_cols=121  Identities=24%  Similarity=0.298  Sum_probs=101.8

Q ss_pred             eEEEEec-CCcEEEEeCCCCeEEEEEccCCceeeEE------EecCCCeEEEEECCCCCEEEEecCCCc---EEEEEeCC
Q psy11518         16 SVRSVAA-TSKLAASSGADETVVLYDMVKRKQSGAL------MQHEGTITCLKFTPEGSHLISCSDDGS---IAIFRVGS   85 (139)
Q Consensus        16 ~v~~~~~-~~~~l~~~~~~~~v~i~~~~~~~~~~~~------~~~~~~v~~~~~~~~~~~l~~~~~d~~---i~~~d~~~   85 (139)
                      .++++.+ ...++++|+.|+.|++||+.+++++..+      .+|...|.+++|+|++++|++|+.|+.   |++||+++
T Consensus       186 ~~~~v~~s~dg~lasgs~Dg~i~iwd~~~~~~~~~~~~~~~l~~h~~~V~~l~~spdg~~l~sgs~D~t~~~i~lwd~~~  265 (393)
T d1sq9a_         186 FATSVDISERGLIATGFNNGTVQISELSTLRPLYNFESQHSMINNSNSIRSVKFSPQGSLLAIAHDSNSFGCITLYETEF  265 (393)
T ss_dssp             CCCEEEECTTSEEEEECTTSEEEEEETTTTEEEEEEECCC---CCCCCEEEEEECSSTTEEEEEEEETTEEEEEEEETTT
T ss_pred             cEEEEEECCCCEEEEEeCCCcEEEEeecccccccccccccccccccceEEEcccccccceeeeecCCCCcceeeeccccc
Confidence            3555665 3348999999999999999998876554      468899999999999999999998874   89999999


Q ss_pred             ceEEEEEEe------------CCCCcceeEEEEccCCcEEEEEcCCCeEEEEEcCCCceeEEEe
Q psy11518         86 WQLEKLFKK------------AHKGTAVNHISIHPSGKLALSVGKDKTLRTWNLVKGRSAYITN  137 (139)
Q Consensus        86 ~~~~~~~~~------------~~~~~~v~~~~~~~~~~~l~~~~~d~~i~i~d~~~~~~~~~~~  137 (139)
                      ++.+..+..            .|... |++++|+|++++|++++.|+.|++||+++++.+..+.
T Consensus       266 g~~~~~l~~~~~~~~~~~~~~gH~~~-V~~l~fspd~~~l~S~s~D~~v~vWd~~~g~~~~~l~  328 (393)
T d1sq9a_         266 GERIGSLSVPTHSSQASLGEFAHSSW-VMSLSFNDSGETLCSAGWDGKLRFWDVKTKERITTLN  328 (393)
T ss_dssp             CCEEEEECBC--------CCBSBSSC-EEEEEECSSSSEEEEEETTSEEEEEETTTTEEEEEEE
T ss_pred             ceeeeeeccccccccceeeeecccCc-eeeeccCCCCCeeEEECCCCEEEEEECCCCCEEEEEC
Confidence            887776631            35554 9999999999999999999999999999999887764



>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure