Diaphorina citri psyllid: psy11519


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MNDQITSALELTISMSLKMCSLSTHSRPAVNRCRLNRPYCLDNIDSLLHLVDPPSIDFRSTVSRSLCRLENVTNFTEFVKAFSQFGGEMVELAHVTGERGGDLKDERRRAQMSAARQVLERSTMLLLTSSKTCLRHPDSETARQNRDTVF
cHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHcccccc
*********ELTISMSLKMCSLSTHSRPAVNRCRLNRPYCLDNIDSLLHLVDPPSIDFRSTVSRSLCRLENVTNFTEFVKAFSQFGGEMVELAHVTGERGGDLKDERRRAQMSAARQVLERSTMLLLTSSKTCLRHPDSETARQNR****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDQITSALELTISMSLKMCSLSTHSRPAVNRCRLNRPYCLDNIDSLLHLVDPPSIDFRSTVSRSLCRLENVTNFTEFVKAFSQFGGEMVELAHVTGERGGDLKDERRRAQMSAARQVLERSTMLLLTSSKTCLRHPDSETARQNRDTVF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alpha-catulin May modulate the Rho pathway signaling by providing a scaffold for the Lbc Rho guanine nucleotide exchange factor (ARHGEF1).confidentO88327
Alpha-catulin May modulate the Rho pathway signaling by providing a scaffold for the Lbc Rho guanine nucleotide exchange factor (ARHGEF1).confidentQ5RC06
Alpha-catulin May modulate the Rho pathway signaling by providing a scaffold for the Lbc Rho guanine nucleotide exchange factor (ARHGEF1).confidentQ9UBT7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005913 [CC]cell-cell adherens junctionprobableGO:0005575, GO:0030054, GO:0070161, GO:0005912, GO:0005911
GO:0007266 [BP]Rho protein signal transductionprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0050789, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0007265, GO:0007264, GO:0035556, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DOW, chain A
Confidence level:very confident
Coverage over the Query: 1-150
View the alignment between query and template
View the model in PyMOL