Diaphorina citri psyllid: psy11524

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320---
MNVSPQRVKMGKSRYGLGMDYLELLSYPEVLRFVKNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNVSPPVYSAAWSPDSNKVLLTQAKSLVIKPLSPNNKATKWQAHDGLILKVAWCSSTDLILSGGEDCKYKASFVWDTDGRQLYSSLTHDHPISSLAWAPGGDMFAVGSYNTLRLCDKVGWSHSLDKPDTGSVYDLVWSNDATQIAGACANVIHIFDISSSSSSNVTAPLSHSHEITQLAVNQTGSLQERHVAFIDKNRDLYLSMWSHSLDKPDTGSVYDLVWSSDATQIAGACANGSLLLGTIIQR
ccccccHcccccccccccccHHHHcccccEEEEcccEEEEECccccEEEEEEcccccEEEEEcccccCCccccEEEEccccccEEEEEEcccccEEEEEEcccCEEEEccccccEEEEccccccEEEEEEcccccEEEEEcccccccccEEEccccccEEEcccccccEEEEEEcccccEEEEECcccEEEEccccccEEEEccccccEEEEEEcccccEEEEEccccEEEEEccccccccccccccccccEEEEEEccccccccccEEEEEEEcccEEEEEEccccccccccEEEEEEcccccEEEEEEccccEEEEEcccc
***************GLGMDYLELLSYPEVLRFVKNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNVSPPVYSAAWSPDSNKVLLTQAKSLVIKPLSPNNKATKWQAHDGLILKVAWCSSTDLILSGGEDCKYKASFVWDTDGRQLYSSLTHDHPISSLAWAPGGDMFAVGSYNTLRLCDKVGWSHSLDKPDTGSVYDLVWSNDATQIAGACANVIHIFDISSSSSSNVTAPLSHSHEITQLAVNQTGSLQERHVAFIDKNRDLYLSMWSHSLDKPDTGSVYDLVWSSDATQIAGACANGSLLLGTIIQR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVSPQRVKMGKSRYGLGMDYLELLSYPEVLRFVKNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNVSPPVYSAAWSPDSNKVLLTQAKSLVIKPLSPNNKATKWQAHDGLILKVAWCSSTDLILSGGEDCKYKASFVWDTDGRQLYSSLTHDHPISSLAWAPGGDMFAVGSYNTLRLCDKVGWSHSLDKPDTGSVYDLVWSNDATQIAGACANVIHIFDISSSSSSNVTAPLSHSHEITQLAVNQTGSLQERHVAFIDKNRDLYLSMWSHSLDKPDTGSVYDLVWSSDATQIAGACANGSLLLGTIIQR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Intraflagellar transport protein 80 homolog Component of the intraflagellar transport (IFT) complex B, which is essential for the development and maintenance of motile and sensory cilia.confidentQ66HB3
Intraflagellar transport protein 80 homolog Component of the intraflagellar transport (IFT) complex B, which is essential for the development and maintenance of motile and sensory cilia.confidentQ8K057

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005929 [CC]ciliumprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YMU, chain A
Confidence level:very confident
Coverage over the Query: 37-320
View the alignment between query and template
View the model in PyMOL