Psyllid ID: psy11524


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320---
MNVSPQRVKMGKSRYGLGMDYLELLSYPEVLRFVKNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNVSPPVYSAAWSPDSNKVLLTQAKSLVIKPLSPNNKATKWQAHDGLILKVAWCSSTDLILSGGEDCKYKASFVWDTDGRQLYSSLTHDHPISSLAWAPGGDMFAVGSYNTLRLCDKVGWSHSLDKPDTGSVYDLVWSNDATQIAGACANVIHIFDISSSSSSNVTAPLSHSHEITQLAVNQTGSLQERHVAFIDKNRDLYLSMWSHSLDKPDTGSVYDLVWSSDATQIAGACANGSLLLGTIIQR
cccccHHHccccccccccccHHHHcccccEEEEcccEEEEEEccccEEEEEEcccccEEEEEcccccEEccccEEEEccccccEEEEEEcccccEEEEEEcccEEEEEccccccEEEEccccccEEEEEEcccccEEEEEcccccccccEEEccccccEEEcccccccEEEEEEcccccEEEEEEcccEEEEccccccEEEEccccccEEEEEEcccccEEEEEccccEEEEEccccccccccccccccccEEEEEEccccccccccEEEEEEEcccEEEEEEccccccccccEEEEEEcccccEEEEEEccccEEEEEcccc
ccccccccccccHHccccccHHHHHHcHHHHHHHHcccEEccccccEEEEEEcccccEEEEEcccccccccccEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEcccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEccccEEEEEEcccccEEEEEccccccccEEEEEEcccccEEEEEcccccccccccEEEEEcEHcccccccEEEEEEcccccEEEEEccccEEEEEEEEcc
mnvspqrvkmgksryglgmdyLELLSYPEVLRFVKNHLtirrydgtvinypisPYISVLHSYaashswpqALSLCrtlnvsppvysaawspdsnkVLLTQAKSlvikplspnnkatkwqahdgLILKVAWCSSTDlilsggedckykasfvwdtdgrqlysslthdhpisslawapggdmfavgsyntlrlcdkvgwshsldkpdtgsvydlvwsndatQIAGACANVIHIfdissssssnvtaplshsheiTQLAVNQTGSLQERHVAFIDKNRDLYLSMWshsldkpdtgsvydlvwssdaTQIAGACANGSLLLGTIIQR
mnvspqrvkmgksryglGMDYLELLSYPEVLRFVKNHltirrydgtviNYPISPYISVLHSYAASHSWPQALSLCRTLNVSPPVYSAAWSPDSNKVLLTQAKSLVIKPLSPNNKATKWQAHDGLILKVAWCSSTDLILSGGEDCKYKASFVWDTDGRQLYSSLTHDHPISSLAWAPGGDMFAVGSYNTLRLCDKVGWSHSLDKPDTGSVYDLVWSNDATQIAGACANVIHIFDISSSSSSNVTAPLSHSHEITQLAVNQTGSLQERHVAFIDKNRDLYLSMWSHSLDKPDTGSVYDLVWSSDATQIAGACANGSLLLGTIIQR
MNVSPQRVKMGKSRYGLGMDYLELLSYPEVLRFVKNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNVSPPVYSAAWSPDSNKVLLTQAKSLVIKPLSPNNKATKWQAHDGLILKVAWCSSTDLILSGGEDCKYKASFVWDTDGRQLYSSLTHDHPISSLAWAPGGDMFAVGSYNTLRLCDKVGWSHSLDKPDTGSVYDLVWSNDATQIAGACANVIHIFDIssssssNVTAPLSHSHEITQLAVNQTGSLQERHVAFIDKNRDLYLSMWSHSLDKPDTGSVYDLVWSSDATQIAGACANGSLLLGTIIQR
*************RYGLGMDYLELLSYPEVLRFVKNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNVSPPVYSAAWSPDSNKVLLTQAKSLVIKPLSPNNKATKWQAHDGLILKVAWCSSTDLILSGGEDCKYKASFVWDTDGRQLYSSLTHDHPISSLAWAPGGDMFAVGSYNTLRLCDKVGWSHSLDKPDTGSVYDLVWSNDATQIAGACANVIHIFDI******************TQLAVNQTGSLQERHVAFIDKNRDLYLSMWSHSLDKPDTGSVYDLVWSSDATQIAGACANGSLLLGTII**
******************MDYLELLSYPEVLRFVKNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNVSPPVYSAAWSPDSNKVLLTQAKSLVIKPLSPNNKATKWQAHDGLILKVAWCSSTDLILSGGEDCKYKASFVWDTDGRQLYSSLTHDHPISSLAWAPGGDMFAVGSYNTLRLCDKVGWSHSLDKPDTGSVYDLVWSNDATQIAGACANVIHIFDISSSSSSNVTAPLSHSHEITQLAVNQTGSLQERHVAFIDKNRDLYLSMWSHSLDKPDTGSVYDLVWSSDATQIAGACANGSLLLGTIIQR
*********MGKSRYGLGMDYLELLSYPEVLRFVKNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNVSPPVYSAAWSPDSNKVLLTQAKSLVIKPLSPNNKATKWQAHDGLILKVAWCSSTDLILSGGEDCKYKASFVWDTDGRQLYSSLTHDHPISSLAWAPGGDMFAVGSYNTLRLCDKVGWSHSLDKPDTGSVYDLVWSNDATQIAGACANVIHIFDISS***********HSHEITQLAVNQTGSLQERHVAFIDKNRDLYLSMWSHSLDKPDTGSVYDLVWSSDATQIAGACANGSLLLGTIIQR
***********K***GLGMDYLELLSYPEVLRFVKNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNVSPPVYSAAWSPDSNKVLLTQAKSLVIKPLSPNNKATKWQAHDGLILKVAWCSSTDLILSGGEDCKYKASFVWDTDGRQLYSSLTHDHPISSLAWAPGGDMFAVGSYNTLRLCDKVGWSHSLDKPDTGSVYDLVWSNDATQIAGACANVIHIFDISSSSSSNVTAPLSHSHEITQLAVNQTGSLQERHVAFIDKNRDLYLSMWSHSLDKPDTGSVYDLVWSSDATQIAGACANGSLLLGTIIQR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVSPQRVKMGKSRYGLGMDYLELLSYPEVLRFVKNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNVSPPVYSAAWSPDSNKVLLTQAKSLVIKPLSPNNKATKWQAHDGLILKVAWCSSTDLILSGGEDCKYKASFVWDTDGRQLYSSLTHDHPISSLAWAPGGDMFAVGSYNTLRLCDKVGWSHSLDKPDTGSVYDLVWSNDATQIAGACANVIHIFDISSSSSSNVTAPLSHSHEITQLAVNQTGSLQERHVAFIDKNRDLYLSMWSHSLDKPDTGSVYDLVWSSDATQIAGACANGSLLLGTIIQR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query323 2.2.26 [Sep-21-2011]
Q9P2H3 777 Intraflagellar transport no N/A 0.439 0.182 0.655 3e-54
Q66HB3 777 Intraflagellar transport yes N/A 0.439 0.182 0.655 5e-54
Q8K057 777 Intraflagellar transport yes N/A 0.439 0.182 0.655 5e-54
P49695742 Probable serine/threonine no N/A 0.650 0.283 0.242 0.0001
P20053465 U4/U6 small nuclear ribon yes N/A 0.625 0.434 0.230 0.0002
Q8BQM81977 Echinoderm microtubule-as no N/A 0.588 0.096 0.238 0.0002
Q6ED651977 Echinoderm microtubule-as no N/A 0.588 0.096 0.238 0.0002
>sp|Q9P2H3|IFT80_HUMAN Intraflagellar transport protein 80 homolog OS=Homo sapiens GN=IFT80 PE=1 SV=3 Back     alignment and function desciption
 Score =  212 bits (539), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 95/145 (65%), Positives = 116/145 (80%), Gaps = 3/145 (2%)

Query: 83  PVYSAAWSPDSNKVLLTQAKSLVIKPLSPNNKATKWQAHDGLILKVAWCSSTDLILSGGE 142
           PVYS AW PDS KVL T  K L+IKPL PN K  +W+AHDG+ILKV W S  DLILS GE
Sbjct: 149 PVYSVAWGPDSEKVLYTAGKQLIIKPLQPNAKVLQWKAHDGIILKVDWNSVNDLILSAGE 208

Query: 143 DCKYKASFVWDTDGRQLYSSLTHDHPISSLAWAPGGDMFAVGSYNTLRLCDKVGWSHSLD 202
           DCKYK   VWD+ GR LY+S  H+HPI+S+AWAP G++FAVGS++TLRLCDK GWS++L+
Sbjct: 209 DCKYK---VWDSYGRPLYNSQPHEHPITSVAWAPDGELFAVGSFHTLRLCDKTGWSYALE 265

Query: 203 KPDTGSVYDLVWSNDATQIAGACAN 227
           KP+TGS++++ WS D TQIAGAC N
Sbjct: 266 KPNTGSIFNIAWSIDGTQIAGACGN 290




Component of the intraflagellar transport (IFT) complex B, which is essential for the development and maintenance of motile and sensory cilia.
Homo sapiens (taxid: 9606)
>sp|Q66HB3|IFT80_RAT Intraflagellar transport protein 80 homolog OS=Rattus norvegicus GN=Ift80 PE=2 SV=1 Back     alignment and function description
>sp|Q8K057|IFT80_MOUSE Intraflagellar transport protein 80 homolog OS=Mus musculus GN=Ift80 PE=2 SV=1 Back     alignment and function description
>sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 Back     alignment and function description
>sp|P20053|PRP4_YEAST U4/U6 small nuclear ribonucleoprotein PRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP4 PE=1 SV=1 Back     alignment and function description
>sp|Q8BQM8|EMAL5_MOUSE Echinoderm microtubule-associated protein-like 5 OS=Mus musculus GN=Eml5 PE=2 SV=2 Back     alignment and function description
>sp|Q6ED65|EMAL5_RAT Echinoderm microtubule-associated protein-like 5 OS=Rattus norvegicus GN=Eml5 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query323
242008267 745 predicted protein [Pediculus humanus cor 0.455 0.197 0.64 1e-53
149731034 777 PREDICTED: intraflagellar transport prot 0.439 0.182 0.668 1e-53
345796642 777 PREDICTED: intraflagellar transport prot 0.439 0.182 0.662 4e-53
291400088 777 PREDICTED: WD repeat domain 56 [Oryctola 0.439 0.182 0.662 7e-53
126338436 777 PREDICTED: intraflagellar transport prot 0.455 0.189 0.646 7e-53
328909593287 intraflagellar transport protein 80i-lik 0.455 0.512 0.653 7e-53
348581738 722 PREDICTED: intraflagellar transport prot 0.439 0.196 0.662 7e-53
395528244 776 PREDICTED: intraflagellar transport prot 0.455 0.189 0.646 8e-53
149642775 777 intraflagellar transport protein 80 homo 0.439 0.182 0.662 8e-53
403265645 777 PREDICTED: intraflagellar transport prot 0.439 0.182 0.655 9e-53
>gi|242008267|ref|XP_002424928.1| predicted protein [Pediculus humanus corporis] gi|212508542|gb|EEB12190.1| predicted protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  216 bits (551), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 126/150 (84%), Gaps = 3/150 (2%)

Query: 83  PVYSAAWSPDSNKVLLTQAKSLVIKPLSPNNKATKWQAHDGLILKVAWCSSTDLILSGGE 142
           P+Y+AAW PDSN+VLL Q + LVIKPL+PN +  +W+AH+GLILKVAW  S +LI+SGGE
Sbjct: 138 PLYTAAWGPDSNQVLLAQGRMLVIKPLAPNTRPLRWKAHEGLILKVAWNQSNNLIVSGGE 197

Query: 143 DCKYKASFVWDTDGRQLYSSLTHDHPISSLAWAPGGDMFAVGSYNTLRLCDKVGWSHSLD 202
           DCKYK   VWD+ GRQLYS+   ++P++SL+W+PGG++FAVGS+NTL+LCDK+GWSHSLD
Sbjct: 198 DCKYK---VWDSFGRQLYSNALCEYPVTSLSWSPGGEVFAVGSFNTLKLCDKIGWSHSLD 254

Query: 203 KPDTGSVYDLVWSNDATQIAGACANVIHIF 232
           KP++G++Y L WS D TQ+AGAC+N   IF
Sbjct: 255 KPNSGNIYALSWSPDGTQLAGACSNGNIIF 284




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|149731034|ref|XP_001489193.1| PREDICTED: intraflagellar transport protein 80 homolog [Equus caballus] Back     alignment and taxonomy information
>gi|345796642|ref|XP_545256.3| PREDICTED: intraflagellar transport protein 80 homolog [Canis lupus familiaris] Back     alignment and taxonomy information
>gi|291400088|ref|XP_002716383.1| PREDICTED: WD repeat domain 56 [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|126338436|ref|XP_001370716.1| PREDICTED: intraflagellar transport protein 80 homolog [Monodelphis domestica] Back     alignment and taxonomy information
>gi|328909593|gb|AEB61464.1| intraflagellar transport protein 80i-like protein, partial [Equus caballus] Back     alignment and taxonomy information
>gi|348581738|ref|XP_003476634.1| PREDICTED: intraflagellar transport protein 80 homolog [Cavia porcellus] Back     alignment and taxonomy information
>gi|395528244|ref|XP_003766240.1| PREDICTED: intraflagellar transport protein 80 homolog [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|149642775|ref|NP_001092429.1| intraflagellar transport protein 80 homolog [Bos taurus] gi|148744058|gb|AAI42311.1| IFT80 protein [Bos taurus] Back     alignment and taxonomy information
>gi|403265645|ref|XP_003925033.1| PREDICTED: intraflagellar transport protein 80 homolog [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query323
UNIPROTKB|F1PNI0 784 IFT80 "Uncharacterized protein 0.486 0.200 0.621 2.4e-63
ZFIN|ZDB-GENE-041212-50 777 ift80 "intraflagellar transpor 0.486 0.202 0.602 1.3e-62
UNIPROTKB|Q9P2H3 777 IFT80 "Intraflagellar transpor 0.486 0.202 0.614 2.5e-61
UNIPROTKB|E1BT30 780 IFT80 "Uncharacterized protein 0.501 0.207 0.578 1.1e-59
UNIPROTKB|H3BRJ5 948 H3BRJ5 "Uncharacterized protei 0.439 0.149 0.655 1.4e-59
MGI|MGI:1915509 777 Ift80 "intraflagellar transpor 0.486 0.202 0.614 6.8e-54
RGD|1312006 777 Ift80 "intraflagellar transpor 0.486 0.202 0.614 1.2e-53
WB|WBGene00000484 760 che-2 [Caenorhabditis elegans 0.455 0.193 0.493 1.8e-41
FB|FBgn0032891 775 Oseg5 "Oseg5" [Drosophila mela 0.405 0.169 0.401 1.4e-34
UNIPROTKB|F1N0G0 764 F1N0G0 "Uncharacterized protei 0.482 0.204 0.335 1.9e-30
UNIPROTKB|F1PNI0 IFT80 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 548 (198.0 bits), Expect = 2.4e-63, Sum P(2) = 2.4e-63
 Identities = 100/161 (62%), Positives = 122/161 (75%)

Query:    68 WPQALSLCRTL-NVSPPVYSAAWSPDSNKVLLTQAKSLVIKPLSPNNKATKWQAHDGLIL 126
             W +   L  TL     PVYS AW PDS KVL T  K L+IKPL PN K  +W+AHDG+IL
Sbjct:   140 WSKTGMLRSTLAQQGTPVYSVAWGPDSEKVLYTAGKQLIIKPLQPNAKVLQWKAHDGIIL 199

Query:   127 KVAWCSSTDLILSGGEDCKYKASFVWDTDGRQLYSSLTHDHPISSLAWAPGGDMFAVGSY 186
             KV W S  DLILS GEDCKYK   VWD+ GR LY+SL H+HPI+S+AWAP G++FAVGS+
Sbjct:   200 KVDWNSVNDLILSAGEDCKYK---VWDSYGRPLYNSLPHEHPITSVAWAPDGELFAVGSF 256

Query:   187 NTLRLCDKVGWSHSLDKPDTGSVYDLVWSNDATQIAGACAN 227
             +TLRLCDK GWS++L+KP+TGS++++ WS D TQIAGAC N
Sbjct:   257 HTLRLCDKTGWSYALEKPNTGSIFNIAWSIDGTQIAGACGN 297


GO:0060349 "bone morphogenesis" evidence=IEA
GO:0060271 "cilium morphogenesis" evidence=IEA
GO:0007224 "smoothened signaling pathway" evidence=IEA
GO:0005929 "cilium" evidence=IEA
GO:0005813 "centrosome" evidence=IEA
GO:0001649 "osteoblast differentiation" evidence=IEA
ZFIN|ZDB-GENE-041212-50 ift80 "intraflagellar transport 80 homolog (Chlamydomonas)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P2H3 IFT80 "Intraflagellar transport protein 80 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BT30 IFT80 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H3BRJ5 H3BRJ5 "Uncharacterized protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1915509 Ift80 "intraflagellar transport 80" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1312006 Ift80 "intraflagellar transport 80 homolog (Chlamydomonas)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00000484 che-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0032891 Oseg5 "Oseg5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1N0G0 F1N0G0 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8K057IFT80_MOUSENo assigned EC number0.65510.43960.1827yesN/A
Q66HB3IFT80_RATNo assigned EC number0.65510.43960.1827yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query323
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-12
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-11
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-09
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-08
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 9e-05
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score = 66.2 bits (162), Expect = 2e-12
 Identities = 53/247 (21%), Positives = 97/247 (39%), Gaps = 24/247 (9%)

Query: 83  PVYSAAWSPDSNKVLLT-QAKSLVIKPLSPNNKATKWQAHDGLILKVAWCSSTDLILSGG 141
           PV   A S D   +      K++ +  L           H   +  VA+     ++ S  
Sbjct: 53  PVRDVAASADGTYLASGSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSS 112

Query: 142 EDCKYKASFVWDTD-GRQLYSSLTHDHPISSLAWAPGGDMFAVGSYN-TLRLCDKVGWS- 198
            D   K   VWD + G+ L +   H   ++S+A++P G   A  S + T++L D      
Sbjct: 113 RDKTIK---VWDVETGKCLTTLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWDLRTGKC 169

Query: 199 -HSLDKPDTGSVYDLVWSNDATQ-IAGACANVIHIFDISSSSSSNVTAPLSHSHEITQLA 256
             +L    TG V  + +S D  + ++ +    I ++D+S+           H + +  +A
Sbjct: 170 VATLTGH-TGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGT--LRGHENGVNSVA 226

Query: 257 VNQTGSLQERHVAFIDKNRDLYLSMWSHSLDKPD------TGSVYDLVWSSDATQIAGAC 310
            +  G L          + D  + +W     +        T SV  L WS D  ++A   
Sbjct: 227 FSPDGYL------LASGSEDGTIRVWDLRTGECVQTLSGHTNSVTSLAWSPDGKRLASGS 280

Query: 311 ANGSLLL 317
           A+G++ +
Sbjct: 281 ADGTIRI 287


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 323
KOG0271|consensus480 100.0
KOG0272|consensus459 100.0
KOG0286|consensus343 100.0
KOG0271|consensus480 100.0
KOG0279|consensus315 100.0
KOG0272|consensus459 100.0
KOG0284|consensus464 100.0
KOG0645|consensus312 100.0
KOG0315|consensus311 100.0
KOG0263|consensus707 100.0
KOG0273|consensus524 100.0
KOG0318|consensus603 100.0
KOG0279|consensus315 100.0
KOG0293|consensus519 100.0
KOG0291|consensus 893 100.0
KOG0263|consensus707 100.0
KOG0286|consensus343 100.0
KOG0265|consensus338 100.0
KOG0318|consensus603 100.0
KOG0291|consensus 893 100.0
KOG0273|consensus524 100.0
KOG0266|consensus456 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0284|consensus 464 100.0
KOG0645|consensus312 100.0
KOG0295|consensus406 100.0
KOG0295|consensus406 100.0
KOG0285|consensus460 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0277|consensus311 100.0
KOG0315|consensus311 100.0
KOG0266|consensus456 100.0
KOG0285|consensus460 100.0
KOG0306|consensus 888 100.0
KOG0265|consensus338 100.0
KOG0296|consensus399 100.0
KOG0278|consensus334 100.0
KOG0316|consensus307 100.0
KOG0973|consensus 942 100.0
KOG0276|consensus 794 100.0
KOG0643|consensus327 99.98
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.98
KOG0282|consensus503 99.98
KOG0319|consensus 775 99.98
KOG0283|consensus 712 99.98
KOG0292|consensus 1202 99.97
KOG0276|consensus 794 99.97
KOG0313|consensus423 99.97
KOG0305|consensus484 99.97
KOG0641|consensus350 99.97
KOG0275|consensus508 99.97
KOG0292|consensus 1202 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG1407|consensus313 99.97
KOG0310|consensus 487 99.97
PTZ00421 493 coronin; Provisional 99.97
KOG0296|consensus399 99.97
KOG0772|consensus 641 99.97
KOG0640|consensus430 99.97
KOG0281|consensus499 99.97
KOG0278|consensus334 99.97
KOG0282|consensus503 99.97
KOG0319|consensus 775 99.97
KOG0316|consensus307 99.97
KOG0281|consensus499 99.97
KOG1446|consensus311 99.96
KOG0264|consensus422 99.96
PTZ00420 568 coronin; Provisional 99.96
KOG1407|consensus313 99.96
KOG0288|consensus459 99.96
KOG0647|consensus347 99.96
KOG2096|consensus420 99.96
KOG1332|consensus299 99.96
KOG0310|consensus 487 99.96
KOG0275|consensus508 99.96
KOG0277|consensus311 99.95
KOG0293|consensus519 99.95
PTZ00421 493 coronin; Provisional 99.95
KOG0294|consensus362 99.95
KOG0289|consensus506 99.95
KOG0313|consensus423 99.95
KOG0283|consensus712 99.95
KOG1446|consensus311 99.95
KOG0299|consensus479 99.95
KOG1036|consensus323 99.95
KOG0268|consensus433 99.95
KOG2055|consensus514 99.95
KOG0647|consensus347 99.95
PTZ00420 568 coronin; Provisional 99.95
KOG0639|consensus705 99.95
KOG0973|consensus 942 99.95
KOG0641|consensus350 99.94
KOG0300|consensus481 99.94
KOG0301|consensus 745 99.94
KOG1036|consensus323 99.94
KOG0643|consensus327 99.94
KOG0289|consensus506 99.94
KOG0306|consensus 888 99.94
KOG0268|consensus 433 99.94
KOG0639|consensus705 99.94
KOG1274|consensus 933 99.94
KOG0650|consensus733 99.94
KOG0288|consensus459 99.94
KOG0305|consensus484 99.93
KOG0640|consensus430 99.93
KOG2445|consensus361 99.93
KOG0269|consensus 839 99.93
KOG1063|consensus 764 99.93
KOG0308|consensus 735 99.93
KOG0772|consensus 641 99.93
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.93
KOG0274|consensus537 99.93
KOG0274|consensus537 99.93
KOG0299|consensus479 99.92
KOG1539|consensus 910 99.92
KOG2048|consensus 691 99.92
KOG0646|consensus 476 99.92
KOG0294|consensus362 99.92
KOG0308|consensus 735 99.92
KOG0267|consensus 825 99.92
KOG0264|consensus422 99.92
KOG2106|consensus 626 99.92
KOG1063|consensus764 99.92
KOG1408|consensus 1080 99.91
KOG1274|consensus 933 99.91
KOG1332|consensus299 99.91
KOG1538|consensus 1081 99.91
KOG2106|consensus 626 99.91
KOG2096|consensus 420 99.9
KOG0300|consensus481 99.9
KOG0267|consensus 825 99.9
KOG1273|consensus 405 99.9
KOG0646|consensus 476 99.9
KOG1524|consensus 737 99.9
KOG0301|consensus 745 99.89
KOG1539|consensus 910 99.89
KOG0302|consensus440 99.89
KOG4283|consensus 397 99.89
KOG0269|consensus 839 99.89
KOG4328|consensus498 99.88
KOG4328|consensus498 99.88
KOG4283|consensus397 99.88
KOG2048|consensus 691 99.88
KOG1007|consensus370 99.88
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.88
KOG2055|consensus514 99.87
KOG1034|consensus385 99.87
KOG0303|consensus 472 99.87
KOG2919|consensus406 99.87
KOG1524|consensus 737 99.87
KOG0650|consensus733 99.86
KOG0270|consensus463 99.86
KOG1009|consensus 434 99.86
KOG0321|consensus 720 99.86
KOG0302|consensus440 99.86
KOG1445|consensus 1012 99.86
KOG1538|consensus 1081 99.86
KOG0307|consensus 1049 99.85
KOG1273|consensus405 99.85
KOG1408|consensus 1080 99.85
PRK01742429 tolB translocation protein TolB; Provisional 99.85
PRK01742429 tolB translocation protein TolB; Provisional 99.85
KOG0307|consensus 1049 99.85
PRK11028330 6-phosphogluconolactonase; Provisional 99.84
KOG2919|consensus406 99.84
KOG4378|consensus 673 99.84
KOG4497|consensus 447 99.83
KOG1523|consensus361 99.83
KOG0290|consensus364 99.83
KOG2445|consensus361 99.83
KOG4378|consensus 673 99.83
KOG1587|consensus555 99.82
PRK05137435 tolB translocation protein TolB; Provisional 99.82
KOG0270|consensus463 99.82
KOG4497|consensus447 99.82
KOG1188|consensus376 99.82
PRK03629429 tolB translocation protein TolB; Provisional 99.82
PRK03629429 tolB translocation protein TolB; Provisional 99.81
KOG0321|consensus 720 99.81
KOG4227|consensus 609 99.81
PRK05137435 tolB translocation protein TolB; Provisional 99.8
KOG0290|consensus364 99.8
KOG1445|consensus 1012 99.79
PRK02889427 tolB translocation protein TolB; Provisional 99.79
PRK04922433 tolB translocation protein TolB; Provisional 99.79
KOG1009|consensus 434 99.79
PRK04922433 tolB translocation protein TolB; Provisional 99.78
PRK02889427 tolB translocation protein TolB; Provisional 99.78
KOG2394|consensus 636 99.78
KOG1034|consensus385 99.77
KOG0771|consensus398 99.76
KOG0642|consensus577 99.76
COG2319 466 FOG: WD40 repeat [General function prediction only 99.76
KOG1007|consensus370 99.76
KOG0771|consensus398 99.76
KOG2110|consensus 391 99.76
COG2319 466 FOG: WD40 repeat [General function prediction only 99.75
KOG1963|consensus 792 99.75
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.75
KOG0303|consensus 472 99.74
PRK04792448 tolB translocation protein TolB; Provisional 99.73
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.73
PRK11028330 6-phosphogluconolactonase; Provisional 99.73
KOG1963|consensus 792 99.72
KOG2110|consensus391 99.72
KOG2139|consensus445 99.72
PRK00178430 tolB translocation protein TolB; Provisional 99.72
KOG0322|consensus323 99.72
KOG4227|consensus 609 99.72
PRK00178430 tolB translocation protein TolB; Provisional 99.71
KOG2321|consensus 703 99.71
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.69
KOG1523|consensus 361 99.69
PRK04792448 tolB translocation protein TolB; Provisional 99.69
KOG0644|consensus 1113 99.68
KOG0649|consensus325 99.68
KOG0642|consensus577 99.68
PRK01029428 tolB translocation protein TolB; Provisional 99.67
KOG1272|consensus 545 99.67
KOG1188|consensus 376 99.67
PRK01029428 tolB translocation protein TolB; Provisional 99.66
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.66
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.66
KOG1272|consensus 545 99.65
KOG2111|consensus346 99.64
KOG1240|consensus1431 99.64
KOG1587|consensus555 99.63
PRK04043419 tolB translocation protein TolB; Provisional 99.62
KOG1517|consensus1387 99.62
KOG1310|consensus 758 99.62
KOG0649|consensus325 99.62
KOG0322|consensus323 99.61
KOG2139|consensus 445 99.6
KOG1310|consensus 758 99.59
KOG2111|consensus346 99.58
PRK04043419 tolB translocation protein TolB; Provisional 99.58
KOG1334|consensus559 99.57
KOG2321|consensus 703 99.56
COG4946 668 Uncharacterized protein related to the periplasmic 99.56
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.55
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.55
KOG1517|consensus1387 99.54
KOG0644|consensus 1113 99.54
KOG3881|consensus412 99.54
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.53
KOG2394|consensus 636 99.53
KOG3881|consensus412 99.49
KOG0974|consensus 967 99.46
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.45
KOG2315|consensus 566 99.44
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.44
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.43
KOG1334|consensus 559 99.43
KOG1409|consensus404 99.43
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.42
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.41
KOG1354|consensus433 99.39
KOG1240|consensus 1431 99.37
KOG0280|consensus339 99.35
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.32
COG4946 668 Uncharacterized protein related to the periplasmic 99.3
KOG4547|consensus 541 99.3
COG0823425 TolB Periplasmic component of the Tol biopolymer t 99.29
KOG0309|consensus 1081 99.29
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.28
KOG1064|consensus2439 99.28
KOG0974|consensus 967 99.27
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 99.26
KOG2314|consensus 698 99.25
KOG2315|consensus 566 99.22
KOG3914|consensus390 99.22
KOG2041|consensus 1189 99.21
KOG2041|consensus 1189 99.21
KOG0280|consensus339 99.16
KOG1354|consensus433 99.14
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.14
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.09
KOG1409|consensus 404 99.06
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.06
COG0823425 TolB Periplasmic component of the Tol biopolymer t 99.06
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.05
KOG4532|consensus344 99.03
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.03
KOG2314|consensus 698 99.02
KOG4547|consensus 541 98.99
KOG4714|consensus319 98.98
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.92
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.91
KOG4190|consensus1034 98.91
KOG3914|consensus 390 98.9
KOG2066|consensus 846 98.88
KOG1912|consensus 1062 98.87
KOG1920|consensus 1265 98.86
KOG0309|consensus 1081 98.83
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.81
KOG1064|consensus2439 98.8
KOG4532|consensus344 98.78
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.78
KOG2695|consensus425 98.76
PRK02888 635 nitrous-oxide reductase; Validated 98.73
KOG1920|consensus 1265 98.72
KOG4190|consensus1034 98.69
KOG3621|consensus 726 98.66
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.62
KOG1832|consensus 1516 98.61
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.6
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.6
KOG0882|consensus 558 98.59
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.58
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.58
KOG3617|consensus 1416 98.58
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.55
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.52
KOG1912|consensus 1062 98.52
PRK02888 635 nitrous-oxide reductase; Validated 98.52
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.48
KOG1275|consensus 1118 98.47
PRK13616591 lipoprotein LpqB; Provisional 98.46
KOG4714|consensus319 98.46
KOG1275|consensus 1118 98.4
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.38
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.38
KOG2114|consensus 933 98.37
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.34
KOG2114|consensus 933 98.32
KOG1008|consensus 783 98.3
KOG2066|consensus 846 98.29
COG3391381 Uncharacterized conserved protein [Function unknow 98.28
KOG0882|consensus 558 98.27
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.24
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 98.23
KOG1832|consensus 1516 98.23
KOG2695|consensus425 98.22
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 98.15
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.15
KOG3617|consensus 1416 98.03
KOG3621|consensus 726 98.02
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.0
PRK13616591 lipoprotein LpqB; Provisional 97.97
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 97.92
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.92
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.91
KOG1008|consensus 783 97.9
COG3391381 Uncharacterized conserved protein [Function unknow 97.9
KOG1645|consensus463 97.89
KOG1645|consensus463 97.88
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.88
KOG4640|consensus 665 97.77
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.76
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.73
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.71
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 97.65
KOG4649|consensus354 97.64
KOG4640|consensus 665 97.63
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 97.61
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.58
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.58
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.57
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.53
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.48
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.48
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.47
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.46
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.42
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.4
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.3
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.26
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 97.26
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.23
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 97.23
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.18
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 97.14
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.13
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.11
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.08
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.08
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.01
KOG2395|consensus644 96.98
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 96.84
KOG4649|consensus 354 96.83
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 96.76
PLN00033398 photosystem II stability/assembly factor; Provisio 96.74
KOG2079|consensus 1206 96.71
KOG2395|consensus644 96.67
KOG2280|consensus 829 96.65
PRK10115 686 protease 2; Provisional 96.63
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.54
KOG2280|consensus 829 96.3
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.29
PRK13684334 Ycf48-like protein; Provisional 96.26
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.17
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.04
KOG2377|consensus 657 95.97
KOG2079|consensus 1206 95.94
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 95.93
PF05694 461 SBP56: 56kDa selenium binding protein (SBP56); Int 95.78
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 95.77
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 95.7
KOG1897|consensus 1096 95.63
KOG2247|consensus 615 95.62
KOG4499|consensus310 95.61
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 95.6
KOG1897|consensus 1096 95.57
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 95.5
COG5167776 VID27 Protein involved in vacuole import and degra 95.48
KOG3630|consensus 1405 95.43
COG4590 733 ABC-type uncharacterized transport system, permeas 95.21
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 95.21
KOG4499|consensus310 95.18
KOG1916|consensus 1283 95.07
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 94.88
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 94.81
KOG2444|consensus238 94.8
KOG4460|consensus 741 94.78
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 94.74
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.73
PHA02713557 hypothetical protein; Provisional 94.68
KOG2444|consensus238 94.64
KOG2377|consensus 657 94.53
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 94.28
KOG3630|consensus 1405 94.21
PRK13684334 Ycf48-like protein; Provisional 94.14
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 93.97
KOG2247|consensus 615 93.85
PLN00033398 photosystem II stability/assembly factor; Provisio 93.75
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 93.65
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 93.39
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 93.2
KOG4441|consensus571 93.14
KOG1520|consensus376 92.69
COG4590 733 ABC-type uncharacterized transport system, permeas 92.61
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 92.51
KOG1916|consensus 1283 92.36
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 92.24
COG1506 620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 92.06
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 92.05
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 91.92
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 91.92
PHA03098534 kelch-like protein; Provisional 91.73
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 91.66
COG1506 620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 91.62
PRK10115 686 protease 2; Provisional 91.42
KOG4460|consensus 741 91.14
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 90.98
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 90.96
TIGR02171 912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 90.94
PHA02713557 hypothetical protein; Provisional 90.94
KOG1520|consensus376 90.91
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 90.58
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 90.5
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 90.23
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 89.82
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 89.38
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 89.33
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 88.57
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 88.39
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 87.81
KOG4441|consensus571 87.5
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 87.3
PF05935 477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 87.24
COG5167 776 VID27 Protein involved in vacuole import and degra 87.23
PRK13613599 lipoprotein LpqB; Provisional 86.8
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 85.7
TIGR02171 912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 85.4
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 85.12
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 83.94
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 83.26
COG5276370 Uncharacterized conserved protein [Function unknow 83.22
PF13449326 Phytase-like: Esterase-like activity of phytase 83.02
PF12768281 Rax2: Cortical protein marker for cell polarity 82.74
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 82.47
PF13449 326 Phytase-like: Esterase-like activity of phytase 82.4
PHA03098534 kelch-like protein; Provisional 82.39
COG5276370 Uncharacterized conserved protein [Function unknow 82.17
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 82.15
PHA02790480 Kelch-like protein; Provisional 81.79
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 81.58
>KOG0271|consensus Back     alignment and domain information
Probab=100.00  E-value=2.9e-46  Score=291.42  Aligned_cols=270  Identities=19%  Similarity=0.239  Sum_probs=232.0

Q ss_pred             eeeeEeecccceeEeeEeccCCcceeeeeeccccccccceeeec---------CCCCCEEEEEEcCCCCeEEEEeeCCeE
Q psy11524         35 KNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTL---------NVSPPVYSAAWSPDSNKVLLTQAKSLV  105 (323)
Q Consensus        35 ~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---------~~~~~v~~~~~sp~~~~l~~~~~~~~~  105 (323)
                      .....+.||.++|.++.|+|+|    ..+++|+-|.+.++|...         .|...|.|++|+|||+.||+|+.+ |.
T Consensus       106 rCssS~~GH~e~Vl~~~fsp~g----~~l~tGsGD~TvR~WD~~TeTp~~t~KgH~~WVlcvawsPDgk~iASG~~d-g~  180 (480)
T KOG0271|consen  106 RCSSSIAGHGEAVLSVQFSPTG----SRLVTGSGDTTVRLWDLDTETPLFTCKGHKNWVLCVAWSPDGKKIASGSKD-GS  180 (480)
T ss_pred             eeccccCCCCCcEEEEEecCCC----ceEEecCCCceEEeeccCCCCcceeecCCccEEEEEEECCCcchhhccccC-Ce
Confidence            3446789999999999999999    567777766666665432         399999999999999999999777 69


Q ss_pred             EEEeCCCCc---eeEeeccCCCeEEEEECC-----CCCEEEEEcCCCceEeeeEEeCC-CCeeeEeecCCCceeEEEEec
Q psy11524        106 IKPLSPNNK---ATKWQAHDGLILKVAWCS-----STDLILSGGEDCKYKASFVWDTD-GRQLYSSLTHDHPISSLAWAP  176 (323)
Q Consensus       106 v~~~~~~~~---~~~~~~~~~~v~~~~~~~-----~~~~l~~~~~d~~i~~i~v~d~~-~~~~~~~~~~~~~v~~~~~~p  176 (323)
                      |.+||....   ...+.+|...|++++|.|     ..++||+++.||.++   |||+. +.++..+.+|..+|+|+.|--
T Consensus       181 I~lwdpktg~~~g~~l~gH~K~It~Lawep~hl~p~~r~las~skDg~vr---IWd~~~~~~~~~lsgHT~~VTCvrwGG  257 (480)
T KOG0271|consen  181 IRLWDPKTGQQIGRALRGHKKWITALAWEPLHLVPPCRRLASSSKDGSVR---IWDTKLGTCVRTLSGHTASVTCVRWGG  257 (480)
T ss_pred             EEEecCCCCCcccccccCcccceeEEeecccccCCCccceecccCCCCEE---EEEccCceEEEEeccCccceEEEEEcC
Confidence            999997654   567899999999999976     467999999999999   99997 678888999999999999975


Q ss_pred             CCCEEEEEeCC-eEEEEeCCC-Ce--------------------------------------------------------
Q psy11524        177 GGDMFAVGSYN-TLRLCDKVG-WS--------------------------------------------------------  198 (323)
Q Consensus       177 ~~~~l~~~~~~-~i~i~d~~~-~~--------------------------------------------------------  198 (323)
                      +| ++++++.| +|++|+... ..                                                        
T Consensus       258 ~g-liySgS~DrtIkvw~a~dG~~~r~lkGHahwvN~lalsTdy~LRtgaf~~t~~~~~~~se~~~~Al~rY~~~~~~~~  336 (480)
T KOG0271|consen  258 EG-LIYSGSQDRTIKVWRALDGKLCRELKGHAHWVNHLALSTDYVLRTGAFDHTGRKPKSFSEEQKKALERYEAVLKDSG  336 (480)
T ss_pred             Cc-eEEecCCCceEEEEEccchhHHHhhcccchheeeeeccchhhhhccccccccccCCChHHHHHHHHHHHHHhhccCc
Confidence            44 67788777 888887432 11                                                        


Q ss_pred             -----------------------eeecCCCCccEEEEEEcCCCCEEEEEecCc-EEEEEcCCCceeeeecCCCCccceEE
Q psy11524        199 -----------------------HSLDKPDTGSVYDLVWSNDATQIAGACANV-IHIFDISSSSSSNVTAPLSHSHEITQ  254 (323)
Q Consensus       199 -----------------------~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~-i~iwd~~~~~~~~~~~~~~~~~~v~~  254 (323)
                                             +..+.+|..-|..+.||||++++|+++-|+ |++||.++|+.+.+  +.+|-.+|+.
T Consensus       337 erlVSgsDd~tlflW~p~~~kkpi~rmtgHq~lVn~V~fSPd~r~IASaSFDkSVkLW~g~tGk~las--fRGHv~~VYq  414 (480)
T KOG0271|consen  337 ERLVSGSDDFTLFLWNPFKSKKPITRMTGHQALVNHVSFSPDGRYIASASFDKSVKLWDGRTGKFLAS--FRGHVAAVYQ  414 (480)
T ss_pred             ceeEEecCCceEEEecccccccchhhhhchhhheeeEEECCCccEEEEeecccceeeeeCCCcchhhh--hhhccceeEE
Confidence                                   123456788899999999999999999999 99999999999999  8999999999


Q ss_pred             EEEccCCCCccceEEEEeCCCCeEEEecccc----cCCCCccceeEEEEeeCCCeeEeeecCCeEEEEE
Q psy11524        255 LAVNQTGSLQERHVAFIDKNRDLYLSMWSHS----LDKPDTGSVYDLVWSSDATQIAGACANGSLLLGT  319 (323)
Q Consensus       255 ~~~~p~g~~~d~~l~~~~~~~~~~~~~~~~~----~~~~~~~~v~~~~~s~~g~~l~s~~~dg~i~~~~  319 (323)
                      ++|+.|.    +.|..++.|..+++|++.+.    -+.+|...|.++.|+|||+.+++|+.|..+++|.
T Consensus       415 vawsaDs----RLlVS~SkDsTLKvw~V~tkKl~~DLpGh~DEVf~vDwspDG~rV~sggkdkv~~lw~  479 (480)
T KOG0271|consen  415 VAWSADS----RLLVSGSKDSTLKVWDVRTKKLKQDLPGHADEVFAVDWSPDGQRVASGGKDKVLRLWR  479 (480)
T ss_pred             EEeccCc----cEEEEcCCCceEEEEEeeeeeecccCCCCCceEEEEEecCCCceeecCCCceEEEeec
Confidence            9999998    78888888888888888775    4567899999999999999999999999999995



>KOG0272|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13613 lipoprotein LpqB; Provisional Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query323
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.98
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.98
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.98
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.97
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.97
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.97
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.97
3jro_A 753 Fusion protein of protein transport protein SEC13 99.97
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.97
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.97
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.97
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.97
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.97
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.97
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.97
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.97
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.96
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.96
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.96
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.96
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.95
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.95
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.94
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.94
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.93
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.93
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.93
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.93
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.92
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.92
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.92
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.92
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.92
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.92
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.91
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.91
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.91
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.91
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.91
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.9
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.9
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.9
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.9
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.89
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.88
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.88
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.88
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.88
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.88
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.87
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.87
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.86
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.86
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.86
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.85
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.85
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.84
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.83
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.83
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.82
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.82
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.82
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.82
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.82
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.81
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.79
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.78
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.77
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.77
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.77
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.76
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.75
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.75
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.75
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.71
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.71
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.71
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.69
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.68
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.68
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.66
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.65
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.64
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.64
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.62
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.62
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.62
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.61
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.61
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.6
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.6
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.59
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.59
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.57
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.56
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.55
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.54
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.52
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.51
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.51
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.5
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.5
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.48
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.45
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.44
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.43
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.37
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.35
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.35
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.35
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.32
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.31
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.29
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.27
2qe8_A343 Uncharacterized protein; structural genomics, join 99.25
2ece_A462 462AA long hypothetical selenium-binding protein; 99.22
2qe8_A343 Uncharacterized protein; structural genomics, join 99.12
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.12
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.11
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.09
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.09
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.08
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 99.07
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.03
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.01
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.94
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.93
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.9
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.86
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.8
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.78
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.77
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.76
2ece_A462 462AA long hypothetical selenium-binding protein; 98.75
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 98.75
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 98.73
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.72
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.71
3v65_B386 Low-density lipoprotein receptor-related protein; 98.7
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.68
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.68
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.67
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.66
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.64
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.63
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.63
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.59
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.59
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.59
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.57
3kya_A496 Putative phosphatase; structural genomics, joint c 98.56
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.53
3v65_B386 Low-density lipoprotein receptor-related protein; 98.52
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.5
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.48
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.48
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.46
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.4
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.37
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.37
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.36
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.32
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.3
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.3
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.29
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.26
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.25
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.25
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 98.24
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.21
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 98.17
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 98.13
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.12
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.1
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.1
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.09
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.08
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.07
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.07
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.05
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.05
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.02
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.02
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.97
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 97.96
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.91
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.9
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 97.87
3kya_A 496 Putative phosphatase; structural genomics, joint c 97.8
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.75
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.74
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 97.73
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.72
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.7
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.6
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.57
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.55
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.54
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.5
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.48
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.44
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.43
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.36
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.33
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.3
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.12
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.03
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 96.56
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 96.53
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.51
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 96.39
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 96.35
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 96.33
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 95.65
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 95.63
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 95.33
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 95.2
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 94.6
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 94.24
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 94.17
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 93.92
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 93.88
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 93.84
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 93.47
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 93.33
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 92.89
3ott_A 758 Two-component system sensor histidine kinase; beta 92.74
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 92.45
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 91.87
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 91.8
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 91.65
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 91.65
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 91.36
2be1_A 339 Serine/threonine-protein kinase/endoribonuclease; 90.35
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 89.65
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 88.97
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 88.68
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 88.13
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 83.85
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 83.21
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 81.51
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 81.11
3ott_A 758 Two-component system sensor histidine kinase; beta 80.48
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=7e-44  Score=296.32  Aligned_cols=274  Identities=13%  Similarity=0.129  Sum_probs=237.7

Q ss_pred             eEeecccceeEeeEeccCCcceeeeeeccccccccceeee----------c-CCCCCEEEEEEcCCCCeEEEEeeCCeEE
Q psy11524         38 LTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRT----------L-NVSPPVYSAAWSPDSNKVLLTQAKSLVI  106 (323)
Q Consensus        38 ~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----------~-~~~~~v~~~~~sp~~~~l~~~~~~~~~v  106 (323)
                      ..+++|.+.|.+++|+|++..-...+++++.|++.++|..          + .|...|.+++|+|++..+++++.+ +.|
T Consensus        26 ~~~~~H~~~V~~v~~~~~~~~~~~~l~tgs~D~~v~vW~~~~~~~~~~~~l~gh~~~v~~~~~~~~~~~l~s~s~D-~~i  104 (321)
T 3ow8_A           26 KQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVDISHTLPIAASSSLD-AHI  104 (321)
T ss_dssp             EETTSSSSCEEEEEEC-------CEEEEEETTSCEEEEEEETTEEEEEEEECCCSSCEEEEEECSSSSEEEEEETT-SEE
T ss_pred             eecccCCCcEEEEEEecCCCCCCCEEEEEcCCCCEEEEECCCCCeeeeeeeccCCCCEEEEEECCCCCEEEEEeCC-CcE
Confidence            4567999999999999875433356778877777776642          2 389999999999999999998877 599


Q ss_pred             EEeCCCCc--eeEeeccCCCeEEEEECCCCCEEEEEcCCCceEeeeEEeCC-CCeeeEeecCCCceeEEEEecCCCEEEE
Q psy11524        107 KPLSPNNK--ATKWQAHDGLILKVAWCSSTDLILSGGEDCKYKASFVWDTD-GRQLYSSLTHDHPISSLAWAPGGDMFAV  183 (323)
Q Consensus       107 ~~~~~~~~--~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~~i~~i~v~d~~-~~~~~~~~~~~~~v~~~~~~p~~~~l~~  183 (323)
                      ++||....  ...+..|...+.+++|+|++++|++++.|+.|+   +|+++ ++....+..+...+.+++|+|++++|++
T Consensus       105 ~lWd~~~~~~~~~~~~~~~~~~~~~~spdg~~l~~g~~dg~v~---i~~~~~~~~~~~~~~~~~~v~~~~~spdg~~las  181 (321)
T 3ow8_A          105 RLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVN---IFGVESGKKEYSLDTRGKFILSIAYSPDGKYLAS  181 (321)
T ss_dssp             EEEETTTTEEEEEEECCTTCCCCEEECTTSSEEEEECTTSEEE---EEETTTCSEEEEEECSSSCEEEEEECTTSSEEEE
T ss_pred             EEEECCCCCEEEEEeCCCccEEEEEECCCCCEEEEEcCCCcEE---EEEcCCCceeEEecCCCceEEEEEECCCCCEEEE
Confidence            99998765  566788888999999999999999999999999   99995 6777778888899999999999999999


Q ss_pred             EeCC-eEEEEeCCCC-eeeecCCCCccEEEEEEcCCCCEEEEEecCc-EEEEEcCCCceeeeecCCCCccceEEEEEccC
Q psy11524        184 GSYN-TLRLCDKVGW-SHSLDKPDTGSVYDLVWSNDATQIAGACANV-IHIFDISSSSSSNVTAPLSHSHEITQLAVNQT  260 (323)
Q Consensus       184 ~~~~-~i~i~d~~~~-~~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~-i~iwd~~~~~~~~~~~~~~~~~~v~~~~~~p~  260 (323)
                      ++.| .|++||+++. .+..+.+|...|.+++|+|++++|++++.|+ |++||+++++...+  +.+|...|.+++|+|+
T Consensus       182 g~~dg~i~iwd~~~~~~~~~~~~h~~~v~~l~~spd~~~l~s~s~dg~i~iwd~~~~~~~~~--~~~h~~~v~~~~~sp~  259 (321)
T 3ow8_A          182 GAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGT--LSGHASWVLNVAFCPD  259 (321)
T ss_dssp             EETTSCEEEEETTTTEEEEEECCCSSCCCEEEECTTSCEEEEECTTSCEEEEETTTCCEEEE--ECCCSSCEEEEEECTT
T ss_pred             EcCCCeEEEEECCCCcEEEEEcccCCceeEEEEcCCCCEEEEEcCCCeEEEEECCCcceeEE--EcCCCCceEEEEECCC
Confidence            9996 9999998754 5567788999999999999999999999999 99999999998887  7899999999999999


Q ss_pred             CCCccceEEEEeCCCCeEEEecccc----cCCCCccceeEEEEeeCCCeeEeeecCCeEEEEEee
Q psy11524        261 GSLQERHVAFIDKNRDLYLSMWSHS----LDKPDTGSVYDLVWSSDATQIAGACANGSLLLGTII  321 (323)
Q Consensus       261 g~~~d~~l~~~~~~~~~~~~~~~~~----~~~~~~~~v~~~~~s~~g~~l~s~~~dg~i~~~~l~  321 (323)
                      +    ..+++++.++.+++|++...    .+..|...|.+++|+|+|++|++++.||.|++|++.
T Consensus       260 ~----~~l~s~s~D~~v~iwd~~~~~~~~~~~~h~~~v~~v~~s~~g~~l~s~~~d~~i~vwd~p  320 (321)
T 3ow8_A          260 D----THFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHIYDCP  320 (321)
T ss_dssp             S----SEEEEEETTSCEEEEETTTTEEEEEECCCSSCEEEEEECTTSSEEEEEETTCCEEEEECC
T ss_pred             C----CEEEEEeCCCcEEEEeCCCCEEEEEEcCCCCcEEEEEECCCCCEEEEEeCCCeEEEEeCC
Confidence            8    88999999999999998765    455688999999999999999999999999999963



>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 323
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-08
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-07
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 0.003
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 4e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-04
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-07
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-05
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 5e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 8e-05
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-04
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.002
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.001
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.001
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.001
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.002
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 52.8 bits (125), Expect = 2e-08
 Identities = 16/120 (13%), Positives = 42/120 (35%), Gaps = 3/120 (2%)

Query: 117 KWQAHDGLILKVAWCSSTDLILSGGEDCKYKASFVWDTDGRQLYSSLTHDHPISSLAWAP 176
            +  H+  I  + +  + +   +G +D   +   +        YS       I+S++++ 
Sbjct: 221 TFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSK 280

Query: 177 GGDMFAVGSY-NTLRLCDKVGWSHSLD-KPDTGSVYDLVWSNDATQIAGACA-NVIHIFD 233
            G +   G       + D +    +         V  L  ++D   +A     + + I++
Sbjct: 281 SGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN 340


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query323
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.98
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.96
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.96
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.96
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.96
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.95
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.95
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.95
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.95
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.95
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.93
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.93
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.93
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.9
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.87
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.86
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.86
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.84
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.84
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.84
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.83
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.79
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.78
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.74
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.72
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.66
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.64
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.62
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.59
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.58
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.53
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.51
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.45
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.44
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.43
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.4
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.39
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.33
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.26
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.25
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.22
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.21
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.19
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.18
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 99.15
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.1
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.07
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.07
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.04
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.97
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.95
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.92
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.8
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.52
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.92
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.88
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.61
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.35
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.16
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.09
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 96.76
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 96.06
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 95.94
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 95.56
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 95.34
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 95.08
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 94.34
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 93.19
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 93.04
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 92.66
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 91.76
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 91.44
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 91.22
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 91.21
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 90.76
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 90.49
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 88.43
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 86.85
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 86.07
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.8e-40  Score=275.95  Aligned_cols=268  Identities=14%  Similarity=0.124  Sum_probs=224.8

Q ss_pred             cccceeEeeEeccCCcceeeeeecc---ccccc----c---ceeeecCCCCCEEEEEEcCCCCeEEEEeeCCeEEEEeCC
Q psy11524         42 RYDGTVINYPISPYISVLHSYAASH---SWPQA----L---SLCRTLNVSPPVYSAAWSPDSNKVLLTQAKSLVIKPLSP  111 (323)
Q Consensus        42 ~~~~~v~~~~~~~~~~~~~~~~~~~---~~~~~----~---~~~~~~~~~~~v~~~~~sp~~~~l~~~~~~~~~v~~~~~  111 (323)
                      +|...|.+++|+|+|+.+++.. ++   .||-.    .   .......|.+.|.+++|+|+|++|++++.+ +.|++|+.
T Consensus        49 ~H~~~V~~v~fs~~g~~latg~-dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~dg~~l~s~~~d-g~i~iwd~  126 (337)
T d1gxra_          49 NHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEA-STLSIWDL  126 (337)
T ss_dssp             CCSSCCCEEEECSSSSEEEEEC-BSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTSSEEEEEESS-SEEEEEEC
T ss_pred             CCCCcEEEEEECCCCCEEEEEE-CCEEEEEEccCCcccceeEEeeecCCCCcEEEEEEcCCCCEEEEeecc-cccccccc
Confidence            7999999999999997666542 22   25411    1   111223488899999999999999998777 59999997


Q ss_pred             CCc----eeEeeccCCCeEEEEECCCCCEEEEEcCCCceEeeeEEeCC-CCeeeEeecCCCceeEEEEecCCCEEEEEeC
Q psy11524        112 NNK----ATKWQAHDGLILKVAWCSSTDLILSGGEDCKYKASFVWDTD-GRQLYSSLTHDHPISSLAWAPGGDMFAVGSY  186 (323)
Q Consensus       112 ~~~----~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~~i~~i~v~d~~-~~~~~~~~~~~~~v~~~~~~p~~~~l~~~~~  186 (323)
                      ...    ...+..|...+..++|+|++.++++++.|+.++   +|++. ++.......|...+.+++|++++..+++++.
T Consensus       127 ~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~d~~i~---~~~~~~~~~~~~~~~~~~~v~~l~~s~~~~~~~~~~~  203 (337)
T d1gxra_         127 AAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIA---VWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGL  203 (337)
T ss_dssp             CCC--EEEEEEECSSSCEEEEEECTTSSEEEEEETTSCEE---EEETTTTEEEEEECCCSSCEEEEEECTTSSEEEEEET
T ss_pred             cccccccccccccccccccccccccccccccccccccccc---ccccccccccccccccccccccccccccccccccccc
Confidence            644    455678899999999999999999999999999   99996 5556667778999999999999999999998


Q ss_pred             C-eEEEEeCCCCeeeecCCCCccEEEEEEcCCCCEEEEEecCc-EEEEEcCCCceeeeecCCCCccceEEEEEccCCCCc
Q psy11524        187 N-TLRLCDKVGWSHSLDKPDTGSVYDLVWSNDATQIAGACANV-IHIFDISSSSSSNVTAPLSHSHEITQLAVNQTGSLQ  264 (323)
Q Consensus       187 ~-~i~i~d~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~-i~iwd~~~~~~~~~~~~~~~~~~v~~~~~~p~g~~~  264 (323)
                      + .+++||++.........+...|.+++|+|++++|++++.|+ +++||+++++....   ..|...|.+++|+|++   
T Consensus       204 d~~v~i~d~~~~~~~~~~~~~~~i~~l~~~~~~~~l~~~~~d~~i~i~d~~~~~~~~~---~~~~~~i~~v~~s~~g---  277 (337)
T d1gxra_         204 DNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQL---HLHESCVLSLKFAYCG---  277 (337)
T ss_dssp             TSEEEEEETTTTEEEEEEECSSCEEEEEECTTSSEEEEEETTSCEEEEETTSSCEEEE---CCCSSCEEEEEECTTS---
T ss_pred             cccccccccccceeecccccccceEEEEEcccccccceeccccccccccccccccccc---cccccccceEEECCCC---
Confidence            6 99999998665444445888999999999999999999999 99999998887654   7788999999999998   


Q ss_pred             cceEEEEeCCCCeEEEecccc---cCCCCccceeEEEEeeCCCeeEeeecCCeEEEEEee
Q psy11524        265 ERHVAFIDKNRDLYLSMWSHS---LDKPDTGSVYDLVWSSDATQIAGACANGSLLLGTII  321 (323)
Q Consensus       265 d~~l~~~~~~~~~~~~~~~~~---~~~~~~~~v~~~~~s~~g~~l~s~~~dg~i~~~~l~  321 (323)
                       ..+++++.++.+++|+....   ....|...|.+++|+|++++|++|+.||+|+||+|+
T Consensus       278 -~~l~s~s~Dg~i~iwd~~~~~~~~~~~~~~~v~~~~~s~d~~~l~t~s~D~~I~vWdl~  336 (337)
T d1gxra_         278 -KWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVI  336 (337)
T ss_dssp             -SEEEEEETTSEEEEEETTTCCEEEEEECSSCEEEEEECTTSCEEEEEETTSCEEEEEEE
T ss_pred             -CEEEEEeCCCeEEEEECCCCCEEEEccCCCCEEEEEEeCCCCEEEEEeCCCeEEEEEEE
Confidence             78888888888999988764   222357899999999999999999999999999985



>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure