Diaphorina citri psyllid: psy11533


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MYRLYNLDVFEYELDSPMSLYAAIPFVTAHNSHHSVGVFWLNAAETWVDVTRSKSTLTGDVMSKIVNFVSGSGGDGGPRSSTEVRFMSESGE
cEEEEcccccccccccccccccccEEEEECcccccEEEEEccccccEEEEEccccccccccccEEEEECccccccccccccccEEEEEcccc
MYRLYNLDVFEYELDSPMSLYAAIPFVTAHNSHHSVGVFWLNAAETWVDVTRSKSTLTGDVMS*****************ST**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYRLYNLDVFEYELDSPMSLYAAIPFVTAHNSHHSVGVFWLNAAETWVDVTRSKSTLTGDVMSKIVNFVSGSGGDGGPRSSTEVRFMSESGE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Neutral alpha-glucosidase AB Cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc(2)Man(9)GlcNAc(2) oligosaccharide precursor of immature glycoproteins.confidentQ14697
Glucosidase 2 subunit alpha Catalytic subunit of glucosidase 2, which cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc(2)Man(9)GlcNAc(2) oligosaccharide precursor of immature glycoproteins.confidentQ9US55
Neutral alpha-glucosidase AB Cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc(2)Man(9)GlcNAc(2) oligosaccharide precursor of immature glycoproteins.confidentP79403

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0004558 [MF]alpha-glucosidase activityprobableGO:0015926, GO:0016787, GO:0016798, GO:0003824, GO:0003674, GO:0004553
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0043581 [BP]mycelium developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LPP, chain A
Confidence level:very confident
Coverage over the Query: 2-51
View the alignment between query and template
View the model in PyMOL