Diaphorina citri psyllid: psy11549


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-
MAGGIPLAHNTSARIILSNQSLVLQKVSRQSAGTYKCSAINTKGEATSNQLKLRVKYAPICKSDRIVIVGASRSESVDIHCAVEADPPARSFKWKFNNSGETLDVGSERFSSGSRGSMLRYTPVTELDYGTLSCAAQNAIGTQVTPCLYQVVLAGKPQPPQNCSVRNETTSSVHISCTPGYDGGLPQTFTLELYSASDLNLLVNLTNLDTPAFTLEDLGLDGTVLMRVVISGVNAKGRSLPVIWDDFSMSGAHYADDSSLI
ccccEEcccccccEEEEEcccEEEEEccccccCEEEEEEEcccccccccEEEEEEEcccCECccccCEEEECccccEEEEEEEECcccccEEEEEEccccccccccccCEEEcccCEEEEEECccccccCEEEEEEEcccCEEECcEEEEEEEccccccccccEEEECcccEEEEEEEccccccccCEEEEEEEEcccccEEEEEEccccccEEEEEcccccccEEEEEEEEEccccccccccCEEEEccccccccccccc
MAGGIPLAHNTSARIILSNQSLVLQKVSRQSAGTYKCSAINTKGEATSNQLKLRVKYAPICKSDRIVIVGASRSESVDIHCAVEADPPARSFKWKFNNS***************RGSMLRYTPVTELDYGTLSCAAQNAIGTQVTPCLYQVVLAGKPQPPQNCSVRNETTSSVHISCTPGYDGGLPQTFTLELYSASDLNLLVNLTNLDTPAFTLEDLGLDGTVLMRVVISGVNAKGRSLPVI**D**M************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGGIPLAHNTSARIILSNQSLVLQKVSRQSAGTYKCSAINTKGEATSNQLKLRVKYAPICKSDRIVIVGASRSESVDIHCAVEADPPARSFKWKFNNSGETLDVGSERFSSGSRGSMLRYTPVTELDYGTLSCAAQNAIGTQVTPCLYQVVLAGKPQPPQNCSVRNETTSSVHISCTPGYDGGLPQTFTLELYSASDLNLLVNLTNLDTPAFTLEDLGLDGTVLMRVVISGVNAKGRSLPVIWDDFSMSGAHYADDSSLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0000794 [CC]condensed nuclear chromosomeprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005694, GO:0000793, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0030017 [CC]sarcomereprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 1-248
View the alignment between query and template
View the model in PyMOL