Diaphorina citri psyllid: psy11552

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710----

MWSITVLISARIRTITFNLSVTNTRVVHYTTTLQSSPSVPMARAGWVLRTLLLNDESGTLRDRKTSGGRTIARRCASGSELVDWLMSLAPSLAVSRQITTGMWQALLEEGVIYHGKISCFFFSETETIPMERIYYSLYSGGRTIARRCASGSELVDWLMSLAPSLAVSRQITTGMWQALLEEGVIYHVNGEQAFRDKCILYNFWQDKEGSSSQATAQDIAEAEEHLEEALLALARRAPDAILRYILRKQLKKLQNRYLPREYMLHLEREIEDKEEEEKEEEEEERQIGKPLDRTSEDLEQIYEELLHLKPLHHLSNSVRRELAGVVMFEAHPRKGEILFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPRLIITSMVFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPSYQLHMYLEQMAVYFTTTAPDIKGPRRYKFRGPNRFQQITANLDVFLRRFNEIQYWVITEILLVTSLNKRVQILRKMIKLAAYCKEYRNINALFAVLMGLSNVAVSRLSLTWDKLPSKSKKTYTELEALIDPSKNHRAYRQAVSKLQSPVIPFMPLLLKDLAFTHDGNKTVVDGLVNFEKMHMFAQTLRTLRYCRTRHLDHDKTVVDGLVNFEKMHMFAQTLRTLRYCRTRHLVLDPPTPKCESEVKSYVSCLRAMDNQRILTSMSQKLEPRRS

cccEEEEEHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHccEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccccccccccEEccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHccccHHHHHHHHcEEEEEEccccccEEEEccccccEEEEEEccEEEEEEEccEEEEEECcccccccccccccccccccccEEEccccccccEEEEEcccccEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccccccccHHHHHHHHcccccccc

*WSITVLISARIRTITFNLSVTNTRVVHYTTTLQSSPSVPMARAGWVLRTLLLNDESGTLRDRKTSGGRTIARRCASGSELVDWLMSLAPSLAVSRQITTGMWQALLEEGVIYHGKISCFFFSETETIPMERIYYSLYSGGRTIARRCASGSELVDWLMSLAPSLAVSRQITTGMWQALLEEGVIYHVNGEQAFRDKCILYNFWQDKEG***********EAEEHLEEALLALARRAPDAILRYILRKQLKKLQ****************EDKEEEEKEEEEE*********RTSEDLEQIYEELLHLKPLHHLSNSVRRELAGVVMFEAHPRKGEILFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPRLIITSMVFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPSYQLHMYLEQMAVYFTTTAPDIKGPRRYKFRGPNRFQQITANLDVFLRRFNEIQYWVITEILLVTSLNKRVQILRKMIKLAAYCKEYRNINALFAVLMGLSNVAVSRLSLTWDKLPSKSKKTYTELEALIDPSKNHRAYRQAVSKLQSPVIPFMPLLLKDLAFTHDGNKTVVDGLVNFEKMHMFAQTLRTLRYCRTRHLDHDKTVVDGLVNFEKMHMFAQTLRTLRYCRT*HLVLDPPTPKCESEVKSYVSCLRAMDNQRILTSM***L*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MWSITVLISARIRTITFNLSVTNTRVVHYTTTLQSSPSVPMARAGWVLRTLLLNDESGTLRDRKTSGGRTIARRCASGSELVDWLMSLAPSLAVSRQITTGMWQALLEEGVIYHGKISCFFFSETETIPMERIYYSLYSGGRTIARRCASGSELVDWLMSLAPSLAVSRQITTGMWQALLEEGVIYHVNGEQAFRDKCILYNFWQDKEGSSSQATAQDIAEAEEHLEEALLALARRAPDAILRYILRKQLKKLQNRYLPREYxxxxxxxxxxxxxxxxxxxxxxxxIGKPLDRTSEDLEQIYEELLHLKPLHHLSNSVRRELAGVVMFEAHPRKGEILFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPRLIITSMVFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPSYQLHMYLEQMAVYFTTTAPDIKGPRRYKFRGPNRFQQITANLDVFLRRFNEIQYWVITEILLVTSLNKRVQILRKMIKLAAYCKEYRNINALFAVLMGLSNVAVSRLSLTWDKLPSKSKKTYTELEALIDPSKNHRAYRQAVSKLQSPVIPFMPLLLKDLAFTHDGNKTVVDGLVNFEKMHMFAQTLRTLRYCRTRHLDHDKTVVDGLVNFEKMHMFAQTLRTLRYCRTRHLVLDPPTPKCESEVKSYVSCLRAMDNQRILTSMSQKLEPRRS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0016324 [CC]	apical plasma membrane	probable	GO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0016323 [CC]	basolateral plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0007165 [BP]	signal transduction	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0001750 [CC]	photoreceptor outer segment	probable	GO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0031513, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0005622
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0060076 [CC]	excitatory synapse	probable	GO:0005575, GO:0045202
GO:0032403 [MF]	protein complex binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0043197 [CC]	dendritic spine	probable	GO:0044309, GO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995
GO:0001917 [CC]	photoreceptor inner segment	probable	GO:0005575, GO:0044464, GO:0005623
GO:0030424 [CC]	axon	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0050805 [BP]	negative regulation of synaptic transmission	probable	GO:0044057, GO:0050794, GO:0031644, GO:0031645, GO:0051241, GO:0050804, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0051239, GO:0023051, GO:0048519, GO:0051969, GO:0010646, GO:0051970, GO:0050789, GO:0048523
GO:0014911 [BP]	positive regulation of smooth muscle cell migration	probable	GO:0051272, GO:0030335, GO:0030334, GO:0040017, GO:0014910, GO:0040012, GO:0008150, GO:0051270, GO:2000145, GO:2000147, GO:0048518, GO:0065007, GO:0032879, GO:0050794, GO:0050789, GO:0048522

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CF6, chain E
Confidence level:very confident
Coverage over the Query: 443-637,672-711
View the alignment between query and template
View the model in PyMOL

Template: 4DIN, chain B
Confidence level:very confident
Coverage over the Query: 285-442,457-487
View the alignment between query and template
View the model in PyMOL

Template: 1O7F, chain A
Confidence level:very confident
Coverage over the Query: 166-249,290-392
View the alignment between query and template
View the model in PyMOL

Template: 4F7Z, chain A
Confidence level:very confident
Coverage over the Query: 35-91,166-249,290-631,666-712
View the alignment between query and template
View the model in PyMOL

Template: 2BYV, chain E
Confidence level:very confident
Coverage over the Query: 480-643,677-712
View the alignment between query and template
View the model in PyMOL

Template: 1UHW, chain A
Confidence level:confident
Coverage over the Query: 96-126
View the alignment between query and template
View the model in PyMOL

Template: 2BYV, chain E
Confidence level:confident
Coverage over the Query: 480-643,677-712
View the alignment between query and template
View the model in PyMOL

Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 221-249,260-304
View the alignment between query and template
View the model in PyMOL