Diaphorina citri psyllid: psy1157

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MEFIMGGTAAAGAAFFTNPLDVVKVRFQLQGELKAKGLYAVHYKNLFHAFFQIAKHDGFLALQKGLMPAACHQVVLNGVRLGTYQVAEERGWTMGPDGNVYILNNIAVGLMAGGAGAFLGSPILLKISLAIQRGHCSSIMSTLPSGNM
cccHHHHHHHHccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccEEEcHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccccc
MEFIMGGTAAAGAAFFTNPLDVVKVRFQLQGELKAKGLYAVHYKNLFHAFFQIAKHDGFLALQKGLMPAACHQVVLNGVRLGTYQVAEERGWTMGPDGNVYILNNIAVGLMAGGAGAFLGSPILLKISLAIQR********TLP*G**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFIMGGTAAAGAAFFTNPLDVVKVRFQLQGELKAKGLYAVHYKNLFHAFFQIAKHDGFLALQKGLMPAACHQVVLNGVRLGTYQVAEERGWTMGPDGNVYILNNIAVGLMAGGAGAFLGSPILLKISLAIQRGHCSSIMSTLPSGNM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Solute carrier family 25 member 35 confidentQ58DS3
Solute carrier family 25 member 35 confidentA3KPP4
Solute carrier family 25 member 35 confidentQ5SWT3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005740 [CC]mitochondrial envelopeprobableGO:0031967, GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005739, GO:0031975, GO:0044446, GO:0044444, GO:0044429, GO:0005575, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 1-144
View the alignment between query and template
View the model in PyMOL