Diaphorina citri psyllid: psy11588


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46
MVWTCCKCIAKYTSRSHLSLHLLSHSSDADEIKQELSCEQCGCSLDFHSALYTKDVYHCADCEQVFLDKFVLELHLKIEHKDNMFPKSHWFVCKMCGHRLFMRLSDLRRHMQDYHCEFHFDVESCAVSRLQDITFPCEECKELCVLSKYCIKHQDCSKAMSTPAPSSESVCIKHSNLIPKCHSCQKCEESFDNCNNLWSHMFIKHENSDFVCNLCPSHSKVLVRYVHSAVRHMKKHHKLQLSIPKAHNYFRKKTVIHVNKKVNYKCPDCSAILLSYGGFTSHLDIHSGEKDHCCHICKKVFLRYRNLVCHIKAVHEKVRDHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFVQWGSLNQHNLVHTAVNVVCSYCGNTYKNPKSLESHIRYAHTIRQKSICDVCGKEFKMKKRLKEHMAVHTTDRPFVCDMCPSAFKLKKHLQQHYKVHLKKD
cccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccHHHHHHcccccc
MVWTCCKCIAKYTSRSHLSLHLLSHSSDADEIKQELSCEQCGCSLDFHSALYTKDVYHCADCEQVFLDKFVLELHLKIEHKDNMFPKSHWFVCKMCGHRLFMRLSDLRRHMQDYHCEFHFDVESCAVSRLQDITFPCEECKELCVLSKYCIKHQDCSKAMSTPAPSSESVCIKHSNLIPKCHSCQKCEESFDNCNNLWSHMFIKHENSDFVCNLCPSHSKVLVRYVHSAVRHMKKHHKLQLSIPKAHNYFRKKTVIHVNKKVNYKCPDCSAILLSYGGFTSHLDIHSGEKDHCCHICKKVFLRYRNLVCHIKAVHEKVRDHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFVQWGSLNQHNLVHTAVNVVCSYCGNTYKNPKSLESHIRYAHTIRQKSICDVCGKEFKMKKRLKEHMAVHTTDRPFVCDMCPSAFKLKKHLQQHYKVHL***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVWTCCKCIAKYTSRSHLSLHLLSHSSDADEIKQELSCEQCGCSLDFHSALYTKDVYHCADCEQVFLDKFVLELHLKIEHKDNMFPKSHWFVCKMCGHRLFMRLSDLRRHMQDYHCEFHFDVESCAVSRLQDITFPCEECKELCVLSKYCIKHQDCSKAMSTPAPSSESVCIKHSNLIPKCHSCQKCEESFDNCNNLWSHMFIKHENSDFVCNLCPSHSKVLVRYVHSAVRHMKKHHKLQLSIPKAHNYFRKKTVIHVNKKVNYKCPDCSAILLSYGGFTSHLDIHSGEKDHCCHICKKVFLRYRNLVCHIKAVHEKVRDHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFVQWGSLNQHNLVHTAVNVVCSYCGNTYKNPKSLESHIRYAHTIRQKSICDVCGKEFKMKKRLKEHMAVHTTDRPFVCDMCPSAFKLKKHLQQHYKVHLKKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UBD, chain C
Confidence level:very confident
Coverage over the Query: 320-428
View the alignment between query and template
View the model in PyMOL
Template: 1UBD, chain C
Confidence level:very confident
Coverage over the Query: 348-456
View the alignment between query and template
View the model in PyMOL
Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 301-455
View the alignment between query and template
View the model in PyMOL
Template: 2LT7, chain A
Confidence level:very confident
Coverage over the Query: 253-361
View the alignment between query and template
View the model in PyMOL
Template: 2CTU, chain A
Confidence level:very confident
Coverage over the Query: 14-96
View the alignment between query and template
View the model in PyMOL
Template: 2EL4, chain A
Confidence level:confident
Coverage over the Query: 170-215
View the alignment between query and template
View the model in PyMOL
Template: 2D9K, chain A
Confidence level:probable
Coverage over the Query: 15-27,54-118
View the alignment between query and template
View the model in PyMOL
Template: 2K5C, chain A
Confidence level:probable
Coverage over the Query: 91-147
View the alignment between query and template
View the model in PyMOL